EPHA7 Polyclonal antibody

• 

  WB analysis of mouse heart using 13119-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 13119-1-AP (EPHA7 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

EPHA7 Polyclonal Antibody for ELISA

Cat No. 13119-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

EHK 3, EHK3, EK11, EPH homology kinase 3, EPH like kinase 11, EPH receptor A7, EPHA7, Ephrin type A receptor 7, HEK11

---

Product Information

13119-1-AP targets EPHA7 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3813

  Product name: Recombinant human EPHA7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 29-279 aa of BC027940

  Sequence: AAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNVRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCECK

• Full Name: EPH receptor A7
• Calculated Molecular Weight: 998 aa, 112 kDa
• GenBank Accession Number: BC027940
• Gene Symbol: EPHA7
• Gene ID (NCBI): 2045
• RRID: AB_2099663
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15375
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.