Use Able AI chat for product recommendations

Mouse Epha7 Recombinant monoclonal antibody, PBS Only

Epha7 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87966-1-PBS
Clone No.253531B5

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, Indirect ELISA

Developmental kinase 1, EBK, EC:2.7.10.1, Ehk3, EHK-3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

87966-1-PBS targets Epha7 in WB, Indirect ELISA applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg8773

Product name: Recombinant mouse Epha7 protein

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 28-555 aa of NM_010141.4

Sequence: QAAKEVLLLDSKAQQTELEWISSPPSGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIVENLAVFPDTVTGSEFSSLVEVRGTCVSSAEEEAENSPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRRFYKSSSQDLQCSRCPTHSFSDREGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVQLSWQEPEHPNGVITEYEIKYYEKDQRERTYSTLKTKSTSASINNLKPGTVYVFQIRAVTAAGYGNYSPRLDVATLEEASGKMFEATAVSSEQNPV

Predict reactive species
Full Name Eph receptor A7
Calculated Molecular Weight112 kDa
Observed Molecular Weight75 kDa, 120 kDa
GenBank Accession NumberNM_010141.4
Gene Symbol Epha7
Gene ID (NCBI) 13841
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ61772-1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

EPH receptor A7 (EPHA7) is a member of the Eph receptor family of receptor tyrosine kinases (RTKs) that mediates contact-dependent cell-cell communication through binding to ephrin-A ligands. In mice, Epha7 is prominently expressed during embryonic development, particularly in the central nervous system, where it regulates axon guidance, neuronal connectivity, cortical patterning, and cell positioning. EPHA7 signaling can induce cell repulsion, boundary formation, and apoptosis, contributing to proper tissue organization. In addition to developmental roles, Epha7 is also detected in selected adult tissues, including brain and lymphoid compartments, although at lower levels. Functionally, EPHA7 has been implicated in neurodevelopmental processes, synaptic organization, and tissue morphogenesis. Emerging evidence suggests roles in tumor biology, where EPHA7 may act as a tumor suppressor or context-dependent regulator of cell proliferation and survival. Due to its involvement in developmental signaling and disease, EPHA7 is of interest in neuroscience, developmental biology, and cancer research.

Loading...
||
New chat

Able

正在加载,请稍候...