Epha7 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Epha7 Recombinant monoclonal antibody (87966-1-RR)

• 

  WB analysis using 87966-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87966-1-RR (Epha7 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 87966-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87966-1-RR (Epha7 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

Epha7 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87966-1-RR

Clone No.253531B5

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, ELISA

Synonyms

Developmental kinase 1, EBK, EC:2.7.10.1, Ehk3, EHK-3

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse cerebellum tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87966-1-RR targets Epha7 in WB, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg8773

  Product name: Recombinant mouse Epha7 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 28-555 aa of NM_010141.4

  Sequence: QAAKEVLLLDSKAQQTELEWISSPPSGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIVENLAVFPDTVTGSEFSSLVEVRGTCVSSAEEEAENSPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRRFYKSSSQDLQCSRCPTHSFSDREGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVQLSWQEPEHPNGVITEYEIKYYEKDQRERTYSTLKTKSTSASINNLKPGTVYVFQIRAVTAAGYGNYSPRLDVATLEEASGKMFEATAVSSEQNPV

• Full Name: Eph receptor A7
• Calculated Molecular Weight: 112 kDa
• Observed Molecular Weight: 75 kDa, 120 kDa
• GenBank Accession Number: NM_010141.4
• Gene Symbol: Epha7
• Gene ID (NCBI): 13841
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q61772-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EPH receptor A7 (EPHA7) is a member of the Eph receptor family of receptor tyrosine kinases (RTKs) that mediates contact-dependent cell-cell communication through binding to ephrin-A ligands. In mice, Epha7 is prominently expressed during embryonic development, particularly in the central nervous system, where it regulates axon guidance, neuronal connectivity, cortical patterning, and cell positioning. EPHA7 signaling can induce cell repulsion, boundary formation, and apoptosis, contributing to proper tissue organization. In addition to developmental roles, Epha7 is also detected in selected adult tissues, including brain and lymphoid compartments, although at lower levels. Functionally, EPHA7 has been implicated in neurodevelopmental processes, synaptic organization, and tissue morphogenesis. Emerging evidence suggests roles in tumor biology, where EPHA7 may act as a tumor suppressor or context-dependent regulator of cell proliferation and survival. Due to its involvement in developmental signaling and disease, EPHA7 is of interest in neuroscience, developmental biology, and cancer research.