Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells, SH-SY5Y cells, mouse liver tissue, rat liver tissue |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human breast cancer tissue, mouse brain tissue, mouse brown adipose tissue, rat brown adipose tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 7 publications below |
| WB | See 269 publications below |
| IHC | See 39 publications below |
| IF | See 17 publications below |
| IP | See 7 publications below |
| CoIP | See 1 publications below |
Product Information
10624-2-AP targets FASN in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, chicken, zebrafish, bovine, sheep, goat, duck |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0975 Product name: Recombinant human FASN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 142-439 aa of BC007909 Sequence: QTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG Predict reactive species |
| Full Name | fatty acid synthase |
| Calculated Molecular Weight | 272 kDa |
| Observed Molecular Weight | 250-272 kDa |
| GenBank Accession Number | BC007909 |
| Gene Symbol | FASN |
| Gene ID (NCBI) | 2194 |
| RRID | AB_2100801 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P49327 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FASN gene codes for an enzyme essential for de novo fatty acid synthesis and cellular substrate energy metabolism. Active FASN is a homodimer in which each peptide subunit has a molecular weight of 260 kDa. FASN is overexpressed in various types of cancer including glioblastomas and is a potential therapeutic target. Recently FASN has been reported to contribute to the neurogenesis since FASN mutation caused intellectual disability in mice.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for FASN antibody 10624-2-AP | Download protocol |
| IF protocol for FASN antibody 10624-2-AP | Download protocol |
| IHC protocol for FASN antibody 10624-2-AP | Download protocol |
| IP protocol for FASN antibody 10624-2-AP | Download protocol |
| WB protocol for FASN antibody 10624-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Metab High dietary fructose promotes hepatocellular carcinoma progression by enhancing O-GlcNAcylation via microbiota-derived acetate | ||
Nat Cancer Integrative proteogenomic profiling of high-risk prostate cancer samples from Chinese patients indicates metabolic vulnerabilities and diagnostic biomarkers | ||
Cell Metab Elevation of JAML Promotes Diabetic Kidney Disease by Modulating Podocyte Lipid Metabolism. | ||
Cell Metab TMEM41B acts as an ER scramblase required for lipoprotein biogenesis and lipid homeostasis. | ||
Nat Commun A nanoemulsion targeting adipose hypertrophy and hyperplasia shows anti-obesity efficiency in female mice | ||
Nat Commun Senescence-associated 13-HODE production promotes age-related liver steatosis by directly inhibiting catalase activity |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Megha (Verified Customer) (01-26-2026) | This product worked fine in western blot, at the correct molecular weight mark. In some blots, it does produce to lines around the same molecular weight location
|
FH MALLIKARJUNA (Verified Customer) (11-26-2025) | GOOD FOR WB APPLICATION
|
FH YINGJIAN (Verified Customer) (08-07-2025) | Clear signal and very low background—saved a lot of optimization time
![]() |
FH K (Verified Customer) (12-20-2020) | I got good results with this Ab for WB at (1:1000) and IHC (1:200)
|
FH Iram (Verified Customer) (09-18-2020) | FASN antibody gives a very clean bands.Excellent antibody
|




















