FKBP11 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84478-6-RR (same clone as 84478-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84478-6-RR (FKBP11 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84478-6-PBS in a different storage buffer formulation.

• 

  WB analysis using 84478-6-RR (same clone as 84478-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84478-6-RR (FKBP11 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84478-6-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 84478-6-RR (same clone as 84478-6-PBS)

  WB result of FKBP11 antibody (84478-6-RR; 1:30000; incubated at room temperature for 1.5 hours) with sh-Control and sh-FKBP11 transfected Raji cells. This data was developed using the same antibody clone with 84478-6-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84478-6-RR

  Biolayer interferometry (BLl) kinetic assays of 84478-6-RR against Human FKBP11 were performed. The affinity constant is 1.93 nM.

FKBP11 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84478-6-PBS

Clone No.241912D2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

19 kDa FK506 binding protein, 19 kDa FK506-binding protein, 19 kDa FKBP, 241912D2, EC:5.2.1.8

---

Product Information

84478-6-PBS targets FKBP11 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag11368

  Product name: Recombinant human FKBP11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-201 aa of BC027973

  Sequence: AEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK

• Full Name: FK506 binding protein 11, 19 kDa
• Calculated Molecular Weight: 201 aa, 22 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC027973
• Gene Symbol: FKBP11
• Gene ID (NCBI): 51303
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9NYL4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FKBP11 (FK506 binding protein 11, also named FKBP19) was first described as predominantly expressed in secretory tissues including the pancreas and recent studies have suggested a role in beta cell survival under conditions of ER stress (PMID: 35456020). In addition, FKBP11 appears to play a role in osteoblasts and bone formation where it has been observed to associate with interferon-inducible transmembrane protein 5 (IFITM5) (PMID: 24058703).