FKBP2 Monoclonal antibody

FKBP2 Monoclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 66091-1-Ig
Clone No.2H7E8

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, pig

Applications

WB, IHC, FC (Intra), ELISA

13 kDa FK506-binding protein, 2H7E8, EC:5.2.1.8, FK506-binding protein 2, FKBP 13

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHuman cerebellum tissue, human brain tissue, pig liver tissue, rat brain tissue
Positive IHC detected inhuman prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

66091-1-Ig targets FKBP2 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, rat, pig samples.

Tested Reactivity human, rat, pig
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19113

Product name: Recombinant human FKBP2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-142 aa of BC003384

Sequence: MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL

Predict reactive species
Full Name FK506 binding protein 2, 13kDa
Calculated Molecular Weight 142 aa, 16 kDa
Observed Molecular Weight 16 kDa
GenBank Accession NumberBC003384
Gene Symbol FKBP2
Gene ID (NCBI) 2286
RRIDAB_11232416
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP26885
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FKBP2 is also named as FKBP13 and belongs to the FKBP-type PPIase family. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. FKBP2 has a 21-amino acid signal peptide and appears to be membrane-associated(PMID:1713687). It is localized to the lumen of the endoplasmic reticulum (ER). FKBP12 and FKBP13 are highly similar proteins, of molecular masses 12 kDa and 13 kDa respectively, with approx.43 % amino acid identity. The strong homology between FKBP12 and FKBP13 suggests that they may share similar biological functions, although, apart from rotamase activity, details relating to the function of either protein are scant(PMID:8373365).

Protocols

Product Specific Protocols
FC protocol for FKBP2 antibody 66091-1-IgDownload protocol
IHC protocol for FKBP2 antibody 66091-1-IgDownload protocol
WB protocol for FKBP2 antibody 66091-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Emerg Microbes Infect

Pharmacological suppression of glycogen synthase kinase-3 reactivates HIV-1 from latency via activating Wnt/β-catenin/TCF1 axis in CD4+ T cells.

Authors - Jing Wen

mBio

Tryptophan Metabolism Activates Aryl Hydrocarbon Receptor-Mediated Pathway To Promote HIV-1 Infection and Reactivation.

Authors - Yan-Heng Zhou
Loading...
||
New chat

Able

正在加载,请稍候...