FKBP2 Monoclonal antibody, PBS Only

FKBP2 Monoclonal Antibody for WB, IHC, FC (Intra), Indirect ELISA
Cat No. 66091-1-PBS
Clone No.2H7E8

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, pig

Applications

WB, IHC, FC (Intra), Indirect ELISA

13 kDa FK506-binding protein, 2H7E8, EC:5.2.1.8, FK506-binding protein 2, FKBP 13

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66091-1-PBS targets FKBP2 in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, rat, pig samples.

Tested Reactivity human, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19113

Product name: Recombinant human FKBP2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-142 aa of BC003384

Sequence: MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL

Predict reactive species
Full Name FK506 binding protein 2, 13kDa
Calculated Molecular Weight 142 aa, 16 kDa
Observed Molecular Weight 16 kDa
GenBank Accession NumberBC003384
Gene Symbol FKBP2
Gene ID (NCBI) 2286
RRIDAB_11232416
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP26885
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

FKBP2 is also named as FKBP13 and belongs to the FKBP-type PPIase family. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. FKBP2 has a 21-amino acid signal peptide and appears to be membrane-associated(PMID:1713687). It is localized to the lumen of the endoplasmic reticulum (ER). FKBP12 and FKBP13 are highly similar proteins, of molecular masses 12 kDa and 13 kDa respectively, with approx.43 % amino acid identity. The strong homology between FKBP12 and FKBP13 suggests that they may share similar biological functions, although, apart from rotamase activity, details relating to the function of either protein are scant(PMID:8373365).

Loading...
||
New chat Able
正在加载,请稍候...