FKBPL Polyclonal antibody, PBS Only

• 

  WB analysis of HEK-293 using 10060-1-AP (same clone as 10060-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10060-1-AP (FKBPL antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10060-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 10060-1-AP (same clone as 10060-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 10060-1-AP (FKBPL antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10060-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 10060-1-AP (same clone as 10060-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 10060-1-AP (FKBPL antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10060-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 10060-1-AP (same clone as 10060-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 10060-1-AP (FKBPL antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10060-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 10060-1-AP (same clone as 10060-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 10060-1-AP (FKBPL antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10060-1-PBS in a different storage buffer formulation.

• 

  IP experiment of MCF-7 using 10060-1-AP (same clone as 10060-1-PBS)

  IP result of anti-FKBPL (IP:10060-1-AP, 3ug; Detection:10060-1-AP 1:800) with MCF-7 cells lysate 2500ug. This data was developed using the same antibody clone with 10060-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10060-1-AP (same clone as 10060-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10060-1-AP (FKBPL antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10060-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10060-1-AP (same clone as 10060-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10060-1-AP (FKBPL antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10060-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 10060-1-AP (same clone as 10060-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 10060-1-AP (FKBPL antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10060-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 10060-1-AP (same clone as 10060-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 10060-1-AP (FKBPL antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10060-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 10060-1-AP (same clone as 10060-1-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.4 ug FKBPL Polyclonal antibody (10060-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 10060-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

FKBPL Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA

Cat No. 10060-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, FC (Intra), IP, ELISA

Synonyms

DIR1, FK506-binding protein-like, NG7, WAF-1/CIP1 stabilizing protein 39, WISp39

---

Product Information

10060-1-PBS targets FKBPL in WB, IHC, FC (Intra), IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0112

  Product name: Recombinant human FKBPL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-237 aa of BC004168

  Sequence: ETPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELEVSPDPASQILEHTQGAEKLVAELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKLGSCCRVLALGFPFGSGPPEGWTELTMGVGPWREETWGELIEKCLESMCQGEEAELQLPGHSGPPVRLTLASFTQGRDSWELETSEKEALAREERARGTELFRAGNPEGAARCYGRAL

• Full Name: FK506 binding protein like
• Calculated Molecular Weight: 349 aa, 38 kDa
• Observed Molecular Weight: 42-48 kDa
• GenBank Accession Number: BC004168
• Gene Symbol: FKBPL
• Gene ID (NCBI): 63943
• RRID: AB_2262677
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UIM3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FKBPL, also named as DIR1, NG7 and WISp39, has similarity to the immunophilin protein family, which plays a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBPL levels may be a prognostic indicator and determinant of response to endocrine therapy(PMID:20103631, 15664193). It can be detected the band between 38 kDa and 48 kDa by western blot.