FKBPL Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FKBPL Polyclonal antibody (10060-1-AP)

• Featured Product
• KD/KO Validated

FKBPL Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA

Cat No. 10060-1-AP Copied!

Publications (25)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF, FC (Intra), IP, ChIP, ELISA

Synonyms

DIR1, FK506-binding protein-like, NG7, WAF-1/CIP1 stabilizing protein 39, WISp39

• 

  WB analysis of HEK-293 using 10060-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10060-1-AP (FKBPL antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human testis using 10060-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 10060-1-AP (FKBPL antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 10060-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10060-1-AP (FKBPL antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 10060-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 10060-1-AP (FKBPL antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 10060-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 10060-1-AP (FKBPL antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of MCF-7 using 10060-1-AP

  IP result of anti-FKBPL (IP:10060-1-AP, 3ug; Detection:10060-1-AP 1:800) with MCF-7 cells lysate 2500ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10060-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10060-1-AP (FKBPL antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10060-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10060-1-AP (FKBPL antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 10060-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 10060-1-AP (FKBPL antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 10060-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 10060-1-AP (FKBPL antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using 10060-1-AP

  1x10^6 HeLa cells were intracellularly stained with 0.4 ug FKBPL Polyclonal antibody (10060-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for FKBPL in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, human brain tissue, human testis tissue, Jurkat cells, MCF-7 cells, T-47D cells, MDA-MB-453s cells
• Positive IP detected in: MCF-7 cells
• Positive IHC detected in: human breast cancer tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:300-1:1200
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10060-1-AP targets FKBPL in WB, IHC, IF, FC (Intra), IP, ChIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0112

  Product name: Recombinant human FKBPL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-237 aa of BC004168

  Sequence: ETPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELEVSPDPASQILEHTQGAEKLVAELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKLGSCCRVLALGFPFGSGPPEGWTELTMGVGPWREETWGELIEKCLESMCQGEEAELQLPGHSGPPVRLTLASFTQGRDSWELETSEKEALAREERARGTELFRAGNPEGAARCYGRAL

• Full Name: FK506 binding protein like
• Calculated Molecular Weight: 349 aa, 38 kDa
• Observed Molecular Weight: 42-48 kDa
• GenBank Accession Number: BC004168
• Gene Symbol: FKBPL
• Gene ID (NCBI): 63943
• RRID: AB_2262677
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UIM3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FKBPL, also named as DIR1, NG7 and WISp39, has similarity to the immunophilin protein family, which plays a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBPL levels may be a prognostic indicator and determinant of response to endocrine therapy(PMID:20103631, 15664193). It can be detected the band between 38 kDa and 48 kDa by western blot.

Publications

What published studies show

The Anti-FKBPL antibody (Cat# 10060-1-AP) has 25 citations published in journals including Nature Communications, Cancer Research, Oncogene, Clinical Cancer Research, Journal of Controlled Release, Oncotarget, and PLoS ONE. Associated research fields span breast cancer, angiogenesis, preeclampsia, cardiovascular disease, wound healing, endocrinology, diabetes, heart failure, lung adenocarcinoma, and endometrial carcinoma.

Automatically generated from the 25 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Res; FKBPL regulates estrogen receptor signaling and determines response to endocrine therapy.; Authors - McKeen Hayley D HD
human	WB	Nat Commun; Cytosolic FKBPL and ER-resident CKAP4 co-regulates ER-phagy and protein secretion; Authors - Cathena Meiling Li
mouse,human	WB,IF	J Adv Res; Hsa_circ_0001402 alleviates vascular neointimal hyperplasia through a miR-183-5p-dependent regulation of vascular smooth muscle cell proliferation, migration, and autophagy; Authors - Jia-Jie Lin
human	WB	J Control Release; Delivery of RALA/siFKBPL nanoparticles via electrospun bilayer nanofibres: An innovative angiogenic therapy for wound repair.; Authors - Eoghan J Mulholland ; KD Validated
human	WB,IHC	Clin Cancer Res; FKBPL and peptide derivatives: novel biological agents that inhibit angiogenesis by a CD44-dependent mechanism.; Authors - Valentine Andrea A
mouse,human	WB,IF	J Transl Med; The FKBPL-based therapeutic peptide, AD-01, protects the endothelium from hypoxia-induced damage by stabilising hypoxia inducible factor-α and inflammation; Authors - Sahar Ghorbanpour