FSH beta Monoclonal antibody, PBS Only

• 

  IHC staining of human pituitary using 67131-1-Ig (same clone as 67131-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pituitary tissue slide using 67131-1-Ig (FSH beta antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67131-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pituitary using 67131-1-Ig (same clone as 67131-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pituitary tissue slide using 67131-1-Ig (FSHB antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67131-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pituitary adenoma using 67131-1-Ig (same clone as 67131-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pituitary adenoma tissue slide using 67131-1-Ig (FSH beta antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67131-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67131-1-Ig (same clone as 67131-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using FSH beta antibody (67131-1-Ig, Clone: 1B10A11 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67131-1-PBS in a different storage buffer formulation.

FSH beta Monoclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 67131-1-PBS

Clone No.1B10A11

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

FSHB, 1B10A11, Follicle-stimulating hormone beta subunit, Follitropin beta chain, Follitropin subunit beta

---

Product Information

67131-1-PBS targets FSH beta in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13788

  Product name: Recombinant human FSHB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 19-129 aa of BC113488

  Sequence: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

• Full Name: follicle stimulating hormone, beta polypeptide
• Calculated Molecular Weight: 129 aa, 15 kDa
• GenBank Accession Number: BC113488
• Gene Symbol: FSHB
• Gene ID (NCBI): 2488
• RRID: AB_2882430
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01225
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The FSHB gene encodes the beta subunit of follicle-stimulating hormone (FSH), particularly expressed in gonadotroph cells within the anterior pituitary gland and plays a critical role in the regulation of gonadal function, pubertal maturation and reproductive processes in mammals. The transcription of the FSHB gene is critical for the production of the FSH hormone(PMID:28281143). And FSH is required for ovarian folliculogenesis in females, in males it promotes spermatogenesis in conjunction with testosterone(PMID:11739331). Mutations in FSHB gene would result in infertility both in men and women (PMID: 23766128).