Product Information
67131-1-PBS targets FSH beta in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13788 Product name: Recombinant human FSHB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 19-129 aa of BC113488 Sequence: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE Predict reactive species |
| Full Name | follicle stimulating hormone, beta polypeptide |
| Calculated Molecular Weight | 129 aa, 15 kDa |
| GenBank Accession Number | BC113488 |
| Gene Symbol | FSHB |
| Gene ID (NCBI) | 2488 |
| RRID | AB_2882430 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P01225 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
The FSHB gene encodes the beta subunit of follicle-stimulating hormone (FSH), particularly expressed in gonadotroph cells within the anterior pituitary gland and plays a critical role in the regulation of gonadal function, pubertal maturation and reproductive processes in mammals. The transcription of the FSHB gene is critical for the production of the FSH hormone(PMID:28281143). And FSH is required for ovarian folliculogenesis in females, in males it promotes spermatogenesis in conjunction with testosterone(PMID:11739331). Mutations in FSHB gene would result in infertility both in men and women (PMID: 23766128).







