FSH beta Monoclonal antibody

• 

  IHC staining of human pituitary using 67131-1-Ig

  Immunohistochemical analysis of paraffin-embedded human pituitary tissue slide using 67131-1-Ig (FSH beta antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pituitary using 67131-1-Ig

  Immunohistochemical analysis of paraffin-embedded human pituitary tissue slide using 67131-1-Ig (FSHB antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pituitary adenoma using 67131-1-Ig

  Immunohistochemical analysis of paraffin-embedded human pituitary adenoma tissue slide using 67131-1-Ig (FSH beta antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 67131-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using FSH beta antibody (67131-1-Ig, Clone: 1B10A11 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

FSH beta Monoclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 67131-1-Ig

Clone No.1B10A11

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

IHC, IF/ICC, ELISA

Synonyms

FSHB, 1B10A11, Follicle-stimulating hormone beta subunit, Follitropin beta chain, Follitropin subunit beta

---

Tested Applications

• Positive IHC detected in: human pituitary tissue, human pituitary adenoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67131-1-Ig targets FSH beta in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13788

  Product name: Recombinant human FSHB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 19-129 aa of BC113488

  Sequence: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

• Full Name: follicle stimulating hormone, beta polypeptide
• Calculated Molecular Weight: 129 aa, 15 kDa
• GenBank Accession Number: BC113488
• Gene Symbol: FSHB
• Gene ID (NCBI): 2488
• RRID: AB_2882430
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01225
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The FSHB gene encodes the beta subunit of follicle-stimulating hormone (FSH), particularly expressed in gonadotroph cells within the anterior pituitary gland and plays a critical role in the regulation of gonadal function, pubertal maturation and reproductive processes in mammals. The transcription of the FSHB gene is critical for the production of the FSH hormone(PMID:28281143). And FSH is required for ovarian folliculogenesis in females, in males it promotes spermatogenesis in conjunction with testosterone(PMID:11739331). Mutations in FSHB gene would result in infertility both in men and women (PMID: 23766128).