FSH beta Monoclonal antibody

FSH beta Monoclonal Antibody for IHC, IF/ICC, ELISA
Cat No. 67131-1-Ig
Clone No.1B10A11

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

IHC, IF/ICC, ELISA

FSHB, 1B10A11, Follicle-stimulating hormone beta subunit, Follitropin beta chain, Follitropin subunit beta

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman pituitary tissue, human pituitary adenoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67131-1-Ig targets FSH beta in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag13788

Product name: Recombinant human FSHB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 19-129 aa of BC113488

Sequence: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

Predict reactive species
Full Name follicle stimulating hormone, beta polypeptide
Calculated Molecular Weight 129 aa, 15 kDa
GenBank Accession NumberBC113488
Gene Symbol FSHB
Gene ID (NCBI) 2488
RRIDAB_2882430
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01225
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The FSHB gene encodes the beta subunit of follicle-stimulating hormone (FSH), particularly expressed in gonadotroph cells within the anterior pituitary gland and plays a critical role in the regulation of gonadal function, pubertal maturation and reproductive processes in mammals. The transcription of the FSHB gene is critical for the production of the FSH hormone(PMID:28281143). And FSH is required for ovarian folliculogenesis in females, in males it promotes spermatogenesis in conjunction with testosterone(PMID:11739331). Mutations in FSHB gene would result in infertility both in men and women (PMID: 23766128).

Protocols

Product Specific Protocols
IF protocol for FSH beta antibody 67131-1-IgDownload protocol
IHC protocol for FSH beta antibody 67131-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...