Tested Applications
| Positive WB detected in | human heart tissue, human skeletal muscle tissue, pig heart tissue |
| Positive IHC detected in | human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse heart tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67150-1-Ig targets FXYD1 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, Pig, mouse samples.
| Tested Reactivity | Human, Pig, mouse |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25307 Product name: Recombinant human FXYD1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-92 aa of BC032800 Sequence: MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR Predict reactive species |
| Full Name | FXYD domain containing ion transport regulator 1 |
| Calculated Molecular Weight | 92 aa, 10 kDa |
| Observed Molecular Weight | 15 kDa |
| GenBank Accession Number | BC032800 |
| Gene Symbol | FXYD1 |
| Gene ID (NCBI) | 5348 |
| RRID | AB_2882448 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O00168 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FXYD1, also named as PLM and Phospholemman, belongs to the FXYD family. FXYD1 induces a hyperpolarization-activated chloride current when expressed in Xenopus oocytes. It may have a functional role in muscle contraction. FXYD1 is a partner protein and regulator of the Na+,K+-ATPase (Na+,K+-pump). It may play a role in the acute regulation of the Na+,K+-ATPase response to exercise. (PMID: 20595385, 21653224)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for FXYD1 antibody 67150-1-Ig | Download protocol |
| IHC protocol for FXYD1 antibody 67150-1-Ig | Download protocol |
| WB protocol for FXYD1 antibody 67150-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |













