CoraLite®594-conjugated FXYD1 Monoclonal antibody

FXYD1 Monoclonal Antibody for FC (Intra)
Cat No. CL594-67150
Clone No.2C10G9

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, pig

Applications

FC (Intra)

2C10G9, FXYD domain-containing ion transport regulator 1, Phospholemman, Phospholemman/FXYD1, PLM

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inC2C12 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67150 targets FXYD1 in FC (Intra) applications and shows reactivity with human, mouse, pig samples.

Tested Reactivity human, mouse, pig
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25307

Product name: Recombinant human FXYD1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-92 aa of BC032800

Sequence: MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR

Predict reactive species
Full Name FXYD domain containing ion transport regulator 1
Calculated Molecular Weight 92 aa, 10 kDa
Observed Molecular Weight 15 kDa
GenBank Accession NumberBC032800
Gene Symbol FXYD1
Gene ID (NCBI) 5348
RRIDAB_3084754
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO00168
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

FXYD1, also named as PLM and Phospholemman, belongs to the FXYD family. FXYD1 induces a hyperpolarization-activated chloride current when expressed in Xenopus oocytes. It may have a functional role in muscle contraction. FXYD1 is a partner protein and regulator of the Na+,K+-ATPase (Na+,K+-pump). It may play a role in the acute regulation of the Na+,K+-ATPase response to exercise. (PMID: 20595385, 21653224)

Protocols

Product Specific Protocols
FC protocol for CL594 FXYD1 antibody CL594-67150Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...