CoraLite®594-conjugated FXYD1 Monoclonal antibody

• 

  FC experiment of C2C12 using CL594-67150

  1X10^6 C2C12 cells were intracellularly stained with 0.8 ug CoraLite®594 Anti-Human FXYD1 (CL594-67150, Clone:2C10G9) (red), or 0.8 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

FXYD1 Monoclonal Antibody for FC (Intra)

Cat No. CL594-67150

Clone No.2C10G9

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, pig

Applications

FC (Intra)

Synonyms

2C10G9, FXYD domain-containing ion transport regulator 1, Phospholemman, Phospholemman/FXYD1, PLM

---

Tested Applications

• Positive FC (Intra) detected in: C2C12 cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67150 targets FXYD1 in FC (Intra) applications and shows reactivity with human, mouse, pig samples.

• Tested Reactivity: human, mouse, pig
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25307

  Product name: Recombinant human FXYD1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-92 aa of BC032800

  Sequence: MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR

• Full Name: FXYD domain containing ion transport regulator 1
• Calculated Molecular Weight: 92 aa, 10 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC032800
• Gene Symbol: FXYD1
• Gene ID (NCBI): 5348
• RRID: AB_3084754
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00168
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

FXYD1, also named as PLM and Phospholemman, belongs to the FXYD family. FXYD1 induces a hyperpolarization-activated chloride current when expressed in Xenopus oocytes. It may have a functional role in muscle contraction. FXYD1 is a partner protein and regulator of the Na+,K+-ATPase (Na+,K+-pump). It may play a role in the acute regulation of the Na+,K+-ATPase response to exercise. (PMID: 20595385, 21653224)