FXYD1 Monoclonal antibody, PBS Only

• 

  WB analysis of human heart using 67150-1-Ig (same clone as 67150-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 67150-1-Ig (FXYD1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67150-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human skeletal muscle using 67150-1-Ig (same clone as 67150-1-PBS)

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 67150-1-Ig (FXYD1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67150-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig heart using 67150-1-Ig (same clone as 67150-1-PBS)

  pig heart tissue were subjected to SDS PAGE followed by western blot with 67150-1-Ig (FXYD1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67150-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 67150-1-Ig (same clone as 67150-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 67150-1-Ig (FXYD1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67150-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 67150-1-Ig (same clone as 67150-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 67150-1-Ig (FXYD1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67150-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse heart using 67150-1-Ig (same clone as 67150-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using FXYD1 antibody (67150-1-Ig, Clone: 2C10G9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67150-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse heart using 67150-1-Ig (same clone as 67150-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using FXYD1 antibody (67150-1-Ig, Clone: 2C10G9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67150-1-PBS in a different storage buffer formulation.

FXYD1 Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 67150-1-PBS

Clone No.2C10G9

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Pig, mouse

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

FXYD1, Phospholemman, PLM

---

Product Information

67150-1-PBS targets FXYD1 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with Human, Pig, mouse samples.

• Tested Reactivity: Human, Pig, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25307

  Product name: Recombinant human FXYD1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-92 aa of BC032800

  Sequence: MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR

• Full Name: FXYD domain containing ion transport regulator 1
• Calculated Molecular Weight: 92 aa, 10 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC032800
• Gene Symbol: FXYD1
• Gene ID (NCBI): 5348
• RRID: AB_2882448
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00168
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FXYD1, also named as PLM and Phospholemman, belongs to the FXYD family. FXYD1 induces a hyperpolarization-activated chloride current when expressed in Xenopus oocytes. It may have a functional role in muscle contraction. FXYD1 is a partner protein and regulator of the Na+,K+-ATPase (Na+,K+-pump). It may play a role in the acute regulation of the Na+,K+-ATPase response to exercise. (PMID: 20595385, 21653224)