Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

G3BP1 Monoclonal antibody

G3BP1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66486-1-Ig
Clone No.1E4A2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA

1E4A2, ATP-dependent DNA helicase VIII, EC:3.6.4.12, G3BP, G3BP 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, RAW 264.7 cells, pig brain tissue, HeLa cells, mouse brain tissue, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, 4T1 cells
Positive IHC detected inhuman testis tissue, human colon tissue, human lymphoma tissue, rat brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected insodium arsenite treated HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66486-1-Ig targets G3BP1 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat, pig, monkey, sheep
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag3728

Product name: Recombinant human G3BP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 167-466 aa of BC006997

Sequence: PDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEIQEEKPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRVREQRINIPPQRGPRPIREAGEQGDIEPRRMVRHPDSHQLFIGNLPHEVDKSELKDFFQSYGNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFRGEVRLNVEEKKTRAAREGDRRDNRLRGPGGPRGGLGGGMRGPPRGGMVQKPGFGVGRGLAPRQ

Predict reactive species
Full Name GTPase activating protein (SH3 domain) binding protein 1
Calculated Molecular Weight 466 aa, 52 kDa
Observed Molecular Weight 68 kDa
GenBank Accession NumberBC006997
Gene Symbol G3BP1
Gene ID (NCBI) 10146
RRIDAB_2819031
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ13283
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GAP SH3 Binding Protein 1 (G3BP1), also named as G3BP, is an effector of stress granule (SG) assembly. SG biology plays an important role in the pathophysiology of TDP-43 in ALS and FTLD-U. G3BP1 can be used as a marker of SG. It has been shown to function downstream of Ras and play a role in RNA metabolism, signal transduction, and proliferation. G3BP1 is a ubiquitously expressed protein that localizes to the cytoplasm in proliferating cells and to the nucleus in non-proliferating cells. G3BP1 has recently been implicated in cancer biology.

Protocols

Product Specific Protocols
IF protocol for G3BP1 antibody 66486-1-IgDownload protocol
IHC protocol for G3BP1 antibody 66486-1-IgDownload protocol
WB protocol for G3BP1 antibody 66486-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB,IF

Nature

DDX3X acts as a live-or-die checkpoint in stressed cells by regulating NLRP3 inflammasome.

Authors - Parimal Samir
mouseIF

Nature

Galactosaminogalactan activates the inflammasome to provide host protection.

Authors - Benoit Briard
humanIF

Sci Transl Med

Precise genomic editing of pathogenic mutations in RBM20 rescues dilated cardiomyopathy

Authors - Takahiko Nishiyama
mouseIF

Nat Struct Mol Biol

TDP-43 aggregation induced by oxidative stress causes global mitochondrial imbalance in ALS.

Authors - Xinxin Zuo
humanIF

Nat Commun

Engineering bi-directional chemically-modulated synthetic condensates for cellular control

Authors - Ni Zhen
mouseIF

Brain Behav Immun

Transcriptomic and proteomic profiling of bi-partite and tri-partite murine iPSC-derived neurospheroids under steady-state and inflammatory condition

Authors - Julia Di Stefano

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Xiaochen (Verified Customer) (11-11-2024)

wonderful image

  • Applications: Immunofluorescence
G3BP1 Antibody Immunofluorescence validation ( dilution) in (Cat no:66486-1-Ig)

Haibo (Verified Customer) (10-26-2020)

This is a excellent antibody to visualize stress granules tested in HEK293 and human fibroblasts.

  • Applications: Immunofluorescence
  • Cell Tissue Type: HEK293 and human fibroblasts

Manohar (Verified Customer) (09-23-2020)

1% milk is used

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293

David (Verified Customer) (01-13-2020)

Good signal in control cells and immunopositive puncta seen in response to stress (e.g. sodium arsenite).

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: SH-SY5Y

Azita (Verified Customer) (10-04-2019)

Assembly of stress granula upon treatment with sodium arsenite for 40 min. (It works great)

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1/400
  • Cell Tissue Type: NSC-34
G3BP1 Antibody Immunofluorescence, validation (1/400 dilution) in NSC-34 (Cat no:66486-1-Ig)

Kyosuke (Verified Customer) (06-12-2019)

It works well on HEK293T for Western blot.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: HEK293T

Natalia (Verified Customer) (06-06-2019)

PFA fixated cells

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Hepa1-6 cell line
G3BP1 Antibody Immunofluorescence, validation (1:1000 dilution) in Hepa1-6 cell line (Cat no:66486-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...