Tested Applications
| Positive WB detected in | LNCaP cells, RAW 264.7 cells, pig brain tissue, HeLa cells, mouse brain tissue, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, 4T1 cells |
| Positive IHC detected in | human testis tissue, human colon tissue, rat cerebellum tissue, human lymphoma tissue, mouse cerebellum tissue, rat brain tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | sodium arsenite treated HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66486-1-Ig targets G3BP1 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat, pig, monkey, sheep |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3728 Product name: Recombinant human G3BP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 167-466 aa of BC006997 Sequence: PDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEIQEEKPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRVREQRINIPPQRGPRPIREAGEQGDIEPRRMVRHPDSHQLFIGNLPHEVDKSELKDFFQSYGNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFRGEVRLNVEEKKTRAAREGDRRDNRLRGPGGPRGGLGGGMRGPPRGGMVQKPGFGVGRGLAPRQ Predict reactive species |
| Full Name | GTPase activating protein (SH3 domain) binding protein 1 |
| Calculated Molecular Weight | 466 aa, 52 kDa |
| Observed Molecular Weight | 68 kDa |
| GenBank Accession Number | BC006997 |
| Gene Symbol | G3BP1 |
| Gene ID (NCBI) | 10146 |
| RRID | AB_2819031 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q13283 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GAP SH3 Binding Protein 1 (G3BP1), also named as G3BP, is an effector of stress granule (SG) assembly. SG biology plays an important role in the pathophysiology of TDP-43 in ALS and FTLD-U. G3BP1 can be used as a marker of SG. It has been shown to function downstream of Ras and play a role in RNA metabolism, signal transduction, and proliferation. G3BP1 is a ubiquitously expressed protein that localizes to the cytoplasm in proliferating cells and to the nucleus in non-proliferating cells. G3BP1 has recently been implicated in cancer biology.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for G3BP1 antibody 66486-1-Ig | Download protocol |
| IHC protocol for G3BP1 antibody 66486-1-Ig | Download protocol |
| WB protocol for G3BP1 antibody 66486-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The G3BP1 Monoclonal antibody (Cat# 66486-1-Ig) has 113 citations published in journals including Nature, Immunity, Nat Commun, Cell Metab, Nat Cell Biol, Nat Cancer, Nat Chem, Adv Sci, Oncogene, Brain, Nucleic Acids Res, Cell Rep, Autophagy, Sci Transl Med, and Theranostics. Research fields encompass stress granule biology, liquid-liquid phase separation, neurodegeneration (ALS, stroke, Alzheimer's), oncology, immunology and inflammasome activation, virology, ferroptosis, and metabolic regulation.
| Species | Application | Title |
|---|---|---|
Nature DDX3X acts as a live-or-die checkpoint in stressed cells by regulating NLRP3 inflammasome. | ||
Immunity Ribosome-rescuer PELO catalyzes the oligomeric assembly of NOD-like receptor family proteins via activating their ATPase enzymatic activity |
Reviews
What customers say
All 7 reviews rate this antibody 4–5 stars. Users report excellent performance for immunofluorescence and Western blot, particularly for visualizing stress granules. Tested in HEK293, HEK293T, human fibroblasts, SH-SY5Y, NSC-34, and Hepa1-6 cells, the antibody produces clear, specific signals. Several reviewers highlight strong punctate staining upon stress induction (e.g., sodium arsenite treatment), with dilutions ranging from 1:250 to 1:1000. Overall, users describe it as a reliable, high-quality reagent for stress granule research.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Xiaochen (Verified Customer) (11-11-2024) | wonderful image
 |
Haibo (Verified Customer) (10-26-2020) | This is a excellent antibody to visualize stress granules tested in HEK293 and human fibroblasts.
|
Manohar (Verified Customer) (09-23-2020) | 1% milk is used
|
David (Verified Customer) (01-13-2020) | Good signal in control cells and immunopositive puncta seen in response to stress (e.g. sodium arsenite).
|
Azita (Verified Customer) (10-04-2019) | Assembly of stress granula upon treatment with sodium arsenite for 40 min. (It works great)
 |
Kyosuke (Verified Customer) (06-12-2019) | It works well on HEK293T for Western blot.
|
Natalia (Verified Customer) (06-06-2019) | PFA fixated cells
 |
