GABRA2 Recombinant monoclonal antibody

• 

  FC experiment of HeLa using 83057-4-RR

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug Anti-Human GABRA2 (83057-4-RR, Clone:230158H5) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Rabbit IgG control Rabbit PolyAb (30000-0-AP) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  FC experiment of A549 using 83057-4-RR

  1x10^6 A549 cells were intracellularly stained with 0.25 ug Anti-Human GABRA2 (83057-4-RR, Clone:230158H5) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Rabbit IgG control Rabbit PolyAb (30000-0-AP) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 83057-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83057-4-RR against Human GABRA2 were performed. The affinity constant is below 1 pM.

GABRA2 Uni-rAb^® Recombinant Antibody for FC (Intra), ELISA

Cat No. 83057-4-RR

Clone No.230158H5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra), ELISA

Synonyms

230158H5

---

Tested Applications

• Positive FC (Intra) detected in: HeLa cells, A549 cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83057-4-RR targets GABRA2 in FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29301

  Product name: Recombinant human GABRA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 348-412 aa of NM_000807

  Sequence: SVVNDKKKEKASVMIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKPENKPAEAKKTFN

• Full Name: gamma-aminobutyric acid (GABA) A receptor, alpha 2
• Calculated Molecular Weight: 51 kDa
• Observed Molecular Weight: 50-51 kDa
• GenBank Accession Number: NM_000807
• Gene Symbol: GABRA2
• Gene ID (NCBI): 2555
• RRID: AB_3670784
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P47869
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GABRA2 (gamma-aminobutyric acid type A receptor subunit alpha2), also known as DEE78. It is expected to be located in cell membrane, and the protein is highly expressed in brain. The protein is a ligand-gated chloride channel, which is a component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the brain (PubMed:29961870). It also plays an important role in the formation of functional inhibitory GABAergic synapses in addition to mediating synaptic inhibition as a GABA-gated ion channel (PubMed:29961870). The calculated molecular weight of GABRA2 is 51 kDa.