GALNT2 Recombinant monoclonal antibody, PBS Only (Detector)

GALNT2 Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 83703-2-PBS
Clone No.240723G10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

240723G10, EC:2.4.1.41, GalNAc T2, GalNAc-T2, Polypeptide N-acetylgalactosaminyltransferase 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83703-2-PBS targets GALNT2 as part of a matched antibody pair:

MP00666-1: 83703-1-PBS capture and 83703-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag11523

Product name: Recombinant human GALNT2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 222-571 aa of BC041120

Sequence: FLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQQ

Predict reactive species
Full Name UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2)
Calculated Molecular Weight 571 aa, 65 kDa
Observed Molecular Weight65 kDa
GenBank Accession NumberBC041120
Gene Symbol GALNT2
Gene ID (NCBI) 2590
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ10471
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GALNT2, a GalNAc-transferase involved in O-linked glycosylation, modulates the risk of atherogenic dyslipidemia, a specific hallmark of insulin resistance and acts as a positive modulator of insulin signaling in human liver cells by down-regulating ENPP1. GALNT2 gene encodes GalNAc-T2 as a regulator of high-density lipoprotein cholesterol (HDL-C) metabolism (PMID: 31040393, 27508872). Western blot analysis detected GALNT2 at an apparent molecular mass of 64 kDa.

Loading...
||
New chat Able
正在加载,请稍候...