• Featured Product
  • KD/KO Validated

GANAB Recombinant monoclonal antibody, PBS Only (Capture)

GANAB Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 83324-1-PBS
Clone No.240279B7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

240279B7, Alpha glucosidase 2, Alpha-glucosidase 2, EC:3.2.1.207, G2AN

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83324-1-PBS targets GANAB as part of a matched antibody pair:

MP00350-1: 83324-1-PBS capture and 83324-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag30417

Product name: Recombinant human GANAB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 350-488 aa of BC017435

Sequence: GGTIVPRWMRVRRSSECMKDDPITLFVALSPQGTAQGELFLDDGHTFNYQTRQEFLLRRFSFSGNTLVSSSADPEGHFETPIWIERVVIIGAGKPAAVVLQTKGSPESRLSFQHDPETSVLVLRKPGINVASDWSIHLR

Predict reactive species
Full Name glucosidase, alpha; neutral AB
Calculated Molecular Weight944aa,107 kDa; 488aa,55 kDa
Observed Molecular Weight110 kDa
GenBank Accession NumberBC017435
Gene Symbol GANAB
Gene ID (NCBI) 23193
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14697
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...