GDNF Recombinant monoclonal antibody, PBS Only

• 

  IHC staining of mouse brain using 83087-1-RR (same clone as 83087-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 83087-1-RR (GDNF antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83087-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 83087-1-RR (same clone as 83087-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 83087-1-RR (GDNF antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83087-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 83087-1-RR (same clone as 83087-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 83087-1-RR (GDNF antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83087-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 83087-1-RR (same clone as 83087-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 83087-1-RR (GDNF antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83087-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 83087-1-RR (same clone as 83087-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using GDNF antibody (83087-1-RR, Clone: 230358A10 ) at dilution of 1:250 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83087-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 83087-1-RR (same clone as 83087-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using GDNF antibody (83087-1-RR, Clone: 230358A10 ) at dilution of 1:250 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83087-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 83087-1-RR (same clone as 83087-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using GDNF antibody (83087-1-RR, Clone: 230358A10 ) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 83087-1-PBS in a different storage buffer formulation.

• 

  FC experiment of U-251 using 83087-1-RR (same clone as 83087-1-PBS)

  (blue)1x10^6 U-251 cells were intracellularly stained with 0.25 ug Anti-Human GDNF (83087-1-RR, Clone:230358A10) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:166(red), or 0.25 ug rabbit IgG isotype control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 83087-1-PBS in a different storage buffer formulation.

• 

  FC experiment of SH-SY5Y using 83087-1-RR (same clone as 83087-1-PBS)

  1x10^6 SH-SY5Y cells were intracellularly stained with 0.25 ug Anti-Human GDNF (83087-1-RR, Clone:230358A10) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 83087-1-PBS in a different storage buffer formulation.

GDNF Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA

Cat No. 83087-1-PBS

Clone No.230358A10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA

Synonyms

230358A10, Astrocyte-derived trophic factor, ATF, ATF1, ATF2

---

Product Information

83087-1-PBS targets GDNF in IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24068

  Product name: Recombinant human GDNF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 78-211 aa of BC069369

  Sequence: SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

• Full Name: glial cell derived neurotrophic factor
• Calculated Molecular Weight: 211 aa, 24 kDa
• Observed Molecular Weight: 32-40 kDa
• GenBank Accession Number: BC069369
• Gene Symbol: GDNF
• Gene ID (NCBI): 2668
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P39905
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Glial-derived neurotrophic factor (GDNF) is a member of the transforming growth factor (TGF)-α family and exhibits potent neuroprotective activity. GDNF is a potent promoter of neuronal survival in the CNS and peripheral nervous system (PNS). It has a relatively high speciicity for dopaminergic neurons and thus become an efective treatment for Parkinson's diseases (PD), with clinical trials currently in progress. Protein dimers of GDNF have a reported molecular weight of 32-40 kDa(PMID: 17982417, PMID: 23251488, PMID: 11429269).