• Featured Product
  • KD/KO Validated

GGTLC1 Recombinant monoclonal antibody, PBS Only (Detector)

GGTLC1 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 83392-3-PBS
Clone No.240297D9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

240297D9, Gamma-glutamyltransferase light chain 1, Gamma-glutamyltransferase-like activity 4, Gamma-glutamyltransferase-like protein 6, GGTL6

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83392-3-PBS targets GGTLC1 as part of a matched antibody pair:

MP00433-2: 83392-2-PBS capture and 83392-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag11592

Product name: Recombinant human GGTLC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-225 aa of BC040904

Sequence: MTSEFFSAQLRAQISDDTTHPISYYKPEFYMPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILLNNEMDDFSSTSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITMATALAIIYNLWFGYDVKWAVEEPRLHNQLLPNVTTVERNIDQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY

Predict reactive species
Full Name gamma-glutamyltransferase light chain 1
Calculated Molecular Weight 225 aa, 24 kDa
Observed Molecular Weight20-24 kDa
GenBank Accession NumberBC040904
Gene Symbol GGTLC1
Gene ID (NCBI) 92086
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9BX51
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Gamma-glutamyltransferase light chain 1 (GGTLC1), initially named GGTL6, then GGTLA4, and later GGTLC1 in 2008, is a member of the gamma-glutamyl transferase (GGT) family. The most ubiquitously expressed human GGT gene, GGT1, encodes a single transmembrane polypeptide that is post-translationally processed to form a heavy and a light chain. Knockdown of GGTLC1 in Endometrial cancer (EC) cells was shown to induce G0/G1 phase arrest and apoptosis, underscoring the significance of GGTLC1 as a key regulator of these cellular processes in EC (PMID: 38841516).

Loading...
||
New chat Able
正在加载,请稍候...