GIPR Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87123-1-RR (same clone as 87123-1-PBS)

  HT-1080 cells lysates were subjected to SDS PAGE followed by western blot with 87123-1-RR (GIPR antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87123-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 87123-1-RR (same clone as 87123-1-PBS)

  rat heart tissue lysates were subjected to SDS PAGE followed by western blot with 87123-1-RR (GIPR antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87123-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 87123-1-RR (same clone as 87123-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87123-1-RR (GIPR antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87123-1-PBS in a different storage buffer formulation.

• 

  Affinity of 87123-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87123-1-RR against Human GIPR were performed. The affinity constant is 3.43 nM.

GIPR Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87123-1-PBS

Clone No.252192B7

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Indirect ELISA

Synonyms

GIP R, GIP-R, Glucose-dependent insulinotropic polypeptide receptor

---

Product Information

87123-1-PBS targets GIPR in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg6484

  Product name: Recombinant human GIPR protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 22-138 aa of NM_000164.3

  Sequence: RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ

• Full Name: gastric inhibitory polypeptide receptor
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: NM_000164.3
• Gene Symbol: GIPR
• Gene ID (NCBI): 2696
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P48546
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GIPR, or Gastric Inhibitory Polypeptide Receptor, plays a crucial role in glucose metabolism and insulin secretion. It is a G protein-coupled receptor (GPCR). It belongs to the B1 class of this receptor family, which is involved in various physiological processes including fat generation, pancreatic beta-cell proliferation, and insulin release.