Product Information
87123-1-PBS targets GIPR in WB, Indirect ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg6484 Product name: Recombinant human GIPR protein Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 22-138 aa of NM_000164.3 Sequence: RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ Predict reactive species |
| Full Name | gastric inhibitory polypeptide receptor |
| Calculated Molecular Weight | 53 kDa |
| Observed Molecular Weight | 53 kDa |
| GenBank Accession Number | NM_000164.3 |
| Gene Symbol | GIPR |
| Gene ID (NCBI) | 2696 |
| RRID | AB_3745355 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P48546 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
GIPR, or Gastric Inhibitory Polypeptide Receptor, plays a crucial role in glucose metabolism and insulin secretion. It is a G protein-coupled receptor (GPCR). It belongs to the B1 class of this receptor family, which is involved in various physiological processes including fat generation, pancreatic beta-cell proliferation, and insulin release.







