GIPR Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• GIPR Recombinant monoclonal antibody (87123-1-RR)

• 

  WB analysis using 87123-1-RR

  HT-1080 cells lysates were subjected to SDS PAGE followed by western blot with 87123-1-RR (GIPR antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 87123-1-RR

  rat heart tissue lysates were subjected to SDS PAGE followed by western blot with 87123-1-RR (GIPR antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 87123-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87123-1-RR (GIPR antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87123-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87123-1-RR against Human GIPR were performed. The affinity constant is 3.43 nM.

GIPR Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87123-1-RR

Clone No.252192B7

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, ELISA

Synonyms

GIP R, GIP-R, Glucose-dependent insulinotropic polypeptide receptor

---

Tested Applications

• Positive WB detected in: HT-1080 cells, rat heart tissue, Recombinant protein

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87123-1-RR targets GIPR in WB, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg6484

  Product name: Recombinant human GIPR protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 22-138 aa of NM_000164.3

  Sequence: RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ

• Full Name: gastric inhibitory polypeptide receptor
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: NM_000164.3
• Gene Symbol: GIPR
• Gene ID (NCBI): 2696
• RRID: AB_3745355
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P48546
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GIPR, or Gastric Inhibitory Polypeptide Receptor, plays a crucial role in glucose metabolism and insulin secretion. It is a G protein-coupled receptor (GPCR). It belongs to the B1 class of this receptor family, which is involved in various physiological processes including fat generation, pancreatic beta-cell proliferation, and insulin release.