Tested Applications
| Positive WB detected in | 4T1 cells, HSC-T6 cells, HeLa cells, HepG2 cells |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
| IHC | See 1 publications below |
| IF | See 2 publications below |
Product Information
66889-1-Ig targets GLUT2 in WB, IHC, IF, ELISA applications and shows reactivity with Human, rat, mouse samples.
| Tested Reactivity | Human, rat, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14551 Product name: Recombinant human SLC2A2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 69-128 aa of BC060041 Sequence: SPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDINEMRKEREEASSEQKVSIIQLFTNSSYR Predict reactive species |
| Full Name | solute carrier family 2 (facilitated glucose transporter), member 2 |
| Calculated Molecular Weight | 57 kDa |
| Observed Molecular Weight | 55-60 kDa |
| GenBank Accession Number | BC060041 |
| Gene Symbol | GLUT2 |
| Gene ID (NCBI) | 6514 |
| RRID | AB_2918478 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P11168 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GLUT2 is a member of glucose transporters or GLUTs which catalyze the glucose transport across plasma membrane. GLUT2 is selectively expressed in hepatocytes, pancreatic beta cells, and absorptive renal and intestinal epithelial cells. GLUT2 is required to maintain normal glucose homeostasis and normal function and development of the endocrine pancreas. Its absence leads to symptoms characteristic of non-insulin-dependent diabetes mellitus.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GLUT2 antibody 66889-1-Ig | Download protocol |
| WB protocol for GLUT2 antibody 66889-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Diabetes Res Duodenal-Jejunal Bypass Restores Sweet Taste Receptor-Mediated Glucose Sensing and Absorption in Diabetic Rats | ||
Sci Rep Regulatory mechanisms of glucose absorption in the mouse proximal small intestine during fasting and feeding | ||
Biochem Pharmacol A novel covalent inhibitor alleviates type 2 diabetes mellitus by restraining GSK-3β | ||
Oncol Lett Prediction and verification of the prognostic biomarker SLC2A2 and its association with immune infiltration in gastric cancer | ||
Food Res Int Non-starch polysaccharides from Castanea mollissima Bl. ameliorate metabolic syndrome by remodeling barrier function, microbial community, and metabolites in high-fat-diet/streptozotocin-induced diabetic mice | ||
Nat Commun Metabolomics and proteomics reveal blocking argininosuccinate synthetase 1 alleviates colitis in mice |











