GLUT2 Monoclonal antibody, PBS Only

• 

  WB analysis of 4T1 using 66889-1-Ig (same clone as 66889-1-PBS)

  4T1 cells were subjected to SDS PAGE followed by western blot with 66889-1-Ig (SLC2A2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66889-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 66889-1-Ig (same clone as 66889-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 66889-1-Ig (SLC2A2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66889-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66889-1-Ig (same clone as 66889-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66889-1-Ig (SLC2A2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66889-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 66889-1-Ig (same clone as 66889-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 66889-1-Ig (SLC2A2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66889-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 66889-1-Ig (same clone as 66889-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 66889-1-Ig (GLUT2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66889-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 66889-1-Ig (same clone as 66889-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 66889-1-Ig (GLUT2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66889-1-PBS in a different storage buffer formulation.

GLUT2 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66889-1-PBS

Clone No.1G8B1

Host / Isotype

Mouse / IgG1

Reactivity

Human, rat, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

GLUT 2, GLUT2, SLC2A2

---

Product Information

66889-1-PBS targets GLUT2 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, rat, mouse samples.

• Tested Reactivity: Human, rat, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14551

  Product name: Recombinant human SLC2A2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 69-128 aa of BC060041

  Sequence: SPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDINEMRKEREEASSEQKVSIIQLFTNSSYR

• Full Name: solute carrier family 2 (facilitated glucose transporter), member 2
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC060041
• Gene Symbol: GLUT2
• Gene ID (NCBI): 6514
• RRID: AB_2918478
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P11168
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GLUT2 is a member of glucose transporters or GLUTs which catalyze the glucose transport across plasma membrane. GLUT2 is selectively expressed in hepatocytes, pancreatic beta cells, and absorptive renal and intestinal epithelial cells. GLUT2 is required to maintain normal glucose homeostasis and normal function and development of the endocrine pancreas. Its absence leads to symptoms characteristic of non-insulin-dependent diabetes mellitus.