Product Information
66889-1-PBS targets GLUT2 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, rat, mouse samples.
Tested Reactivity | Human, rat, mouse |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14551 Product name: Recombinant human SLC2A2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 69-128 aa of BC060041 Sequence: SPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDINEMRKEREEASSEQKVSIIQLFTNSSYR Predict reactive species |
Full Name | solute carrier family 2 (facilitated glucose transporter), member 2 |
Calculated Molecular Weight | 57 kDa |
Observed Molecular Weight | 55-60 kDa |
GenBank Accession Number | BC060041 |
Gene Symbol | GLUT2 |
Gene ID (NCBI) | 6514 |
RRID | AB_2918478 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P11168 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
GLUT2 is a member of glucose transporters or GLUTs which catalyze the glucose transport across plasma membrane. GLUT2 is selectively expressed in hepatocytes, pancreatic beta cells, and absorptive renal and intestinal epithelial cells. GLUT2 is required to maintain normal glucose homeostasis and normal function and development of the endocrine pancreas. Its absence leads to symptoms characteristic of non-insulin-dependent diabetes mellitus.