CoraLite®594-conjugated GLUT4 Monoclonal antibody

GLUT4 Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL594-66846
Clone No.3G7C9

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig

Applications

IF/ICC, FC (Intra)

SLC2A4, 3G7C9, Glucose transporter GLUT 4, Glucose transporter type 4, insulin-responsive, GLUT 4

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66846 targets GLUT4 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag15390

Product name: Recombinant human GLUT4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 228-292 aa of BC069615

Sequence: RYLYIIQNLEGPARKSLKRLTGWADVSGVLAELKDEKRKLERERPLSLLQLLGSRTHRQPLIIAV

Predict reactive species
Full Name solute carrier family 2 (facilitated glucose transporter), member 4
Calculated Molecular Weight 509 aa, 55 kDa
Observed Molecular Weight 48-50 kDa
GenBank Accession NumberBC069615
Gene Symbol GLUT4
Gene ID (NCBI) 6517
RRIDAB_3084731
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP14672
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Glucose transporter 4 (GLUT4), also known as solute carrier family 2, facilitated glucose transporter member 4 (SLC2A4), is a transporter protein regulating glucose transport across cell membranes in an INS-dependent manner.

What is the molecular weight of GLUT4? Is GLUT4 post-translationally modified?

The molecular weight of GLUT4 transporter is 55 kDa. GLUT4 can be N-glycosylated, which is important for its stability and trafficking between the recycling compartment and plasma membrane (PMID: 21757715 and 22545627), and it can also be ubiquitinated and phosphorylated (PMID: 23665900).

What is the subcellular localization of GLUT4?

Glucose transporters, including GLUT4, are multiple-pass integral membrane proteins. GLUT4 is present at the plasma membrane but is also a subject of recycling between plasma membrane and endosomes. The localization of GLUT4 depends on stimulation with  INS - in basal conditions GLUT4 is retained intracellularly, while upon  INS stimulation it is translocated to the plasma membrane (PMID: 18570632).

What molecules can be transported by GLUT4?

Although the main substrate of GLUT4 transport is glucose, it can also transport glucosamine.

What is the tissue expression pattern of GLUT4?

GLUT4 is expressed in white and brown adipose tissue and in muscle and heart cells, where it is the main glucose transporter responsible for peripheral glucose uptake in response to INS.

Which cell lines can be used to study insulin-dependent GLUT4 protein translocation in glucose uptake assays?

Fat and muscle cells are primarily used in glucose uptake assays because they physiologically respond to  INS(PMID: 26646194). The most commonly used cell lines are 3T3-L1 cells (murine pre-adipose fibroblasts), L6 cells (rat myoblasts), and C2C12 cells (murine myoblasts).


Protocols

Product Specific Protocols
FC protocol for CL594 GLUT4 antibody CL594-66846Download protocol
IF protocol for CL594 GLUT4 antibody CL594-66846Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...