GNA12 Recombinant monoclonal antibody

• 

  Affinity and Kinetic Characterization of 83263-3-RR

  Biolayer interferometry (BLl) kinetic assays of 83263-3-RR against Human GNA12 were performed. The affinity constant is 1.06 nM.

GNA12 Uni-rAb^® Recombinant Antibody for ELISA

Cat No. 83263-3-RR

Clone No.240050D3

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

ELISA

Synonyms

GNA12, G-protein subunit alpha-12, Guanine nucleotide-binding protein subunit alpha-12, NNX3, RMP, 240050D3, G alpha 12, G alpha-12, G protein subunit alpha 12, gep, GNA 12

---

Product Information

83263-3-RR targets GNA12 in ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35068

  Product name: Recombinant human GNA12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 113-172 aa of BC087537

  Sequence: DKLGIPWQYSENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSE

• Full Name: guanine nucleotide binding protein (G protein) alpha 12
• GenBank Accession Number: BC087537
• Gene Symbol: GNA12
• Gene ID (NCBI): 2768
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q03113
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.