• Featured Product
  • KD/KO Validated

GNA12 Recombinant monoclonal antibody, PBS Only (Capture)

GNA12 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 83263-4-PBS
Clone No.240050E11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

240050E11, G alpha 12, G alpha-12, G protein subunit alpha 12, gep

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83263-4-PBS targets GNA12 as part of a matched antibody pair:

MP00276-1: 83263-4-PBS capture and 83263-3-PBS detection (validated in Cytometric bead array)

MP00276-3: 83263-4-PBS capture and 83263-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag35068

Product name: Recombinant human GNA12 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 113-172 aa of BC087537

Sequence: DKLGIPWQYSENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSE

Predict reactive species
Full Name guanine nucleotide binding protein (G protein) alpha 12
Observed Molecular Weight41 kDa
GenBank Accession NumberBC087537
Gene Symbol GNA12
Gene ID (NCBI) 2768
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ03113
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...