GNB2 Recombinant monoclonal antibody

• 

  WB analysis using 86469-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86469-1-RR (GNB2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

GNB2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86469-1-RR

Clone No.251184B12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

G protein subunit beta-2, Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2

---

Tested Applications

• Positive WB detected in: HeLa cells, ACHN cells, BxPC-3 cells, MCF-7 cells, NIH/3T3 cells, C6 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86469-1-RR targets GNB2 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9125

  Product name: Recombinant human GNB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-340 aa of BC010073

  Sequence: MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN

• Full Name: guanine nucleotide binding protein (G protein), beta polypeptide 2
• Calculated Molecular Weight: 340 aa, 37 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC010073
• Gene Symbol: GNB2
• Gene ID (NCBI): 2783
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P62879
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GNB2(Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2) is also named as G protein subunit beta-2, transducin beta chain 2 and belongs to the WD repeat G protein beta family. G proteins are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.