Tested Applications
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL594-67777 targets GOLPH3 in IF/ICC applications and shows reactivity with Human, Mouse, Rat samples.
| Tested Reactivity | Human, Mouse, Rat |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5443 Product name: Recombinant human GOLPH3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-298 aa of BC033725 Sequence: MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK Predict reactive species |
| Full Name | golgi phosphoprotein 3 (coat-protein) |
| Calculated Molecular Weight | 298 aa, 34 kDa |
| GenBank Accession Number | BC033725 |
| Gene Symbol | GOLPH3 |
| Gene ID (NCBI) | 64083 |
| RRID | AB_2920181 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9H4A6 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
GOLPH3 (also called GPP34, GMx33, MIDAS, or yeast Vps74p) is a 34-kDa Golgi-associated protein conserved from yeast to human. GOLPH3 binds to PtdIns(4)P-rich trans-Golgi membranes and MYO18A conveying a tensile force required for efficient tubule and vesicle formation (PMID: 19837035). GOLPH3 has been recently demonstrated as a novel oncoprotein amplified in various types of human malignancies, including melanoma, breast, non-small cell lung cancer, gliomas and connective tissue tumors (PMID:19553991; 23006319; 21499727; 22745132). Enhanced activation of mTOR signalling represents a molecular basis for the oncogenic activity of GOLPH3 (PMID: 19553991).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL594 GOLPH3 antibody CL594-67777 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

