• Featured Product
  • KD/KO Validated

GPRC5A,RAI3 Polyclonal antibody

GPRC5A,RAI3 Polyclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 10309-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, FC (Intra), ELISA

GPRC5A, GPCR5A, G-protein coupled receptor family C group 5 member A, PEIG-1, Phorbol ester induced gene 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA375 cells, J774A.1 cells, MDA-MB-231 cells, RAW 264.7 cells
Positive IHC detected inhuman lung cancer tissue, human breast cancer tissue, human colon cancer tissue, human lung squamous cell carcinoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10309-1-AP targets GPRC5A,RAI3 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0311

Product name: Recombinant human GPRC5A,RAI3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 106-330 aa of BC003665

Sequence: SICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVGFSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHGAHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQP

Predict reactive species
Full Name G protein-coupled receptor, family C, group 5, member A
Calculated Molecular Weight 40 kDa
Observed Molecular Weight 40 kDa
GenBank Accession NumberBC003665
Gene Symbol GPRC5A
Gene ID (NCBI) 9052
RRIDAB_2877732
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8NFJ5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPRC5A, also named as GPCR5A, RAI3 and RAIG1, belongs to the G-protein coupled receptor 3 family. It is an orphan G-protein coupled receptor (GPCR) that has been associated with malignancy and may play a role in the proliferation of breast cancer cells. GPRC5A is a potential molecular target for treatment of breast cancers. It is suppressed in some human lung carcinoma cells. (PMID:15788639, 20563252, 19552806 )

Protocols

Product Specific Protocols
FC protocol for GPRC5A,RAI3 antibody 10309-1-APDownload protocol
IHC protocol for GPRC5A,RAI3 antibody 10309-1-APDownload protocol
WB protocol for GPRC5A,RAI3 antibody 10309-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
goatIHC

Cell Prolif

Spatially multicellular variability of intervertebral disc degeneration by comparative single-cell analysis

Authors - Peng Lin
humanWB

Sci Total Environ

GPRC5A reduction contributes to pollutant benzo[a]pyrene injury via aggravating murine fibrosis, leading to poor prognosis of IIP patients.

Authors - Ziling Huang
  • KO Validated
HumanWB

Biol Open

Quantitative proteomic profiling of tumor-associated vascular endothelial cells in colorectal cancer.

Authors - Guoqiang Wang
humanWB

Oncol Lett

Clinical significance of reduced GPRC5A expression in surgically resected non-small cell lung cancer.

Authors - Er Jin
humanWB

Exp Lung Res

GPRC5a suppresses the proliferation of non-small cell lung cancer under wild type p53 background.

Authors - Jin Er

Mol Med Rep

Lung cancer suppressor gene GPRC5A mediates p53 activity in non‑small cell lung cancer cells in vitro.

Authors - Er Jin
Loading...
||
New chat

Able

正在加载,请稍候...