• Featured Product
  • KD/KO Validated

GPT2 Polyclonal antibody

GPT2 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA
Cat No. 16757-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

ALAT2, Alanine aminotransferase 2, Glutamic--pyruvic transaminase 2, Glutamic--alanine transaminase 2, EC:2.6.1.2

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue, mouse kidney tissue, HepG2 cells
Positive IP detected inmouse kidney tissue
Positive IHC detected inhuman skeletal muscle tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16757-1-AP targets GPT2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10273

Product name: Recombinant human GPT2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 174-523 aa of BC062555

Sequence: VPADPDNIYLTTGASDGISTILKILVSGGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHINFLEKYA

Predict reactive species
Full Name glutamic pyruvate transaminase (alanine aminotransferase) 2
Calculated Molecular Weight 523 aa, 58 kDa
Observed Molecular Weight 58 kDa, 47 kDa
GenBank Accession NumberBC062555
Gene Symbol GPT2
Gene ID (NCBI) 84706
RRIDAB_2112098
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8TD30
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPT2 (Alanine aminotransferase 2; ALT2) is a key enzyme in intermediatary metabolism, catalysing the reversible transfer of the amino group of glutamate to pyruvate, yielding alanine and ketoglutarate. GPT2 protein localizes to mitochondria, and is mainly expressed in the pancreas, brain, adrenal gland, skeletal muscle and heart. Serum GPT2 is a useful marker for liver damage. Recently mutation of GPT2 has been reported to be a cause of neural disorder (27601654). 16757-1-AP antibody recognizes two different isoforms of GPT2 protein.

Protocols

Product Specific Protocols
WB protocol for GPT2 antibody 16757-1-APDownload protocol
IHC protocol for GPT2 antibody 16757-1-APDownload protocol
IF protocol for GPT2 antibody 16757-1-APDownload protocol
IP protocol for GPT2 antibody 16757-1-APDownload protocol
FC protocol for GPT2 antibody 16757-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Cancer Cell

Inosine induces stemness features in CAR-T cells and enhances potency

Authors - Dorota D Klysz

Cancer Discov

Selective Alanine Transporter Utilization Creates a Targetable Metabolic Niche in Pancreatic Cancer.

Authors - Seth J Parker
WB

Cell Metab

Rewiring of Glutamine Metabolism Is a Bioenergetic Adaptation of Human Cells with Mitochondrial DNA Mutations.

Authors - Qiuying Chen
mouseWB

Cell Res

Glutaminase GLS1 senses glutamine availability in a non-enzymatic manner triggering mitochondrial fusion.

Authors - Wei-Feng Cai
  • KD Validated
humanWB

Nat Commun

Sirtuin5 contributes to colorectal carcinogenesis by enhancing glutaminolysis in a deglutarylation-dependent manner.

Authors - Yun-Qian Wang
humanWB

Cancer Res

Targeting BCAT1 combined with α-ketoglutarate triggers metabolic synthetic lethality in glioblastoma.

Authors - Bo Zhang
Loading...
||
New chat Able
正在加载,请稍候...