• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated GPT2 Polyclonal antibody

GPT2 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-16757

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Alanine aminotransferase 2, ALAT2, ALT2, EC:2.6.1.2, Glutamic--alanine transaminase 2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-16757 targets GPT2 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10273

Product name: Recombinant human GPT2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 174-523 aa of BC062555

Sequence: VPADPDNIYLTTGASDGISTILKILVSGGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHINFLEKYA

Predict reactive species
Full Name glutamic pyruvate transaminase (alanine aminotransferase) 2
Calculated Molecular Weight 523 aa, 58 kDa
Observed Molecular Weight 58 kDa, 47 kDa
GenBank Accession NumberBC062555
Gene Symbol GPT2
Gene ID (NCBI) 84706
RRIDAB_3083991
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8TD30
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

GPT2 (Alanine aminotransferase 2; ALT2) is a key enzyme in intermediatary metabolism, catalysing the reversible transfer of the amino group of glutamate to pyruvate, yielding alanine and ketoglutarate. GPT2 protein localizes to mitochondria, and is mainly expressed in the pancreas, brain, adrenal gland, skeletal muscle and heart. Serum GPT2 is a useful marker for liver damage. Recently mutation of GPT2 has been reported to be a cause of neural disorder (27601654). 16757-1-AP antibody recognizes two different isoforms of GPT2 protein.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 GPT2 antibody CL488-16757Download protocol
IF protocol for CL Plus 488 GPT2 antibody CL488-16757Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...