Published Applications
| KD/KO | See 1 publications below |
| WB | See 1 publications below |
Product Information
24774-1-AP targets GRIN3A in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20416 Product name: Recombinant human GRIN3A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 976-1081 aa of BC132866 Sequence: SQRLHRAINTSFIEEKQQHFKTKRVEKRSNVGPRQLTVWNTSNLSHDNRRKYIFSDEEGQNQLGIRIHQDIPLPPRRRELPALRTTNGKADSLNVSRNSVMQELSE Predict reactive species |
| Full Name | glutamate receptor, ionotropic, N-methyl-D-aspartate 3A |
| Calculated Molecular Weight | 1115 aa, 126 kDa |
| GenBank Accession Number | BC132866 |
| Gene Symbol | GRIN3A |
| Gene ID (NCBI) | 116443 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8TCU5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
