Tested Applications
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-84971-3 targets GS28 in IF/ICC applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag9021 Product name: Recombinant human GS28 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-117 aa of BC012620 Sequence: MAAGTSSYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDRYSSDTTPLLNGSSQDRMFETMAIEIEQLLARLTGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQV Predict reactive species |
| Full Name | golgi SNAP receptor complex member 1 |
| Calculated Molecular Weight | 28.6 kDa |
| Observed Molecular Weight | 28 kDa |
| GenBank Accession Number | BC012620 |
| Gene Symbol | GS28 |
| Gene ID (NCBI) | 9527 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O95249 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
GS28, also known as GOSR1, is a 28-kDa Golgi SNARE protein that participates in ER-Golgi and intra-Golgi transport. GS28 is considered to be a core component of the Golgi SNARE complex. (PMID: 8638159)

