GSK3B Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• GSK3B Recombinant monoclonal antibody (82061-1-RR)

GSK3B Uni-rAb^® Recombinant Antibody for WB, IHC, IP, ELISA

Cat No. 82061-1-RR Copied!

Clone No. 4N21

Publications (37)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

GSK3 beta, EC:2.7.11.1, EC:2.7.11.26, GSK 3 beta, GSK-3 beta

• 

  WB analysis using 82061-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 82061-1-RR (GSK3B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 82061-1-RR

  IP result of anti-GSK3B (IP:82061-1-RR, 4ug; Detection:82061-1-RR 1:5000) with HeLa cells lysate 1720 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skin using 82061-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 82061-1-RR (GSK3B antibody) at dilution of 1:450 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skin using 82061-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 82061-1-RR (GSK3B antibody) at dilution of 1:450 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GSK3B in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, A549 cells, Jurkat cells, PC-12 cells, NIH/3T3 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: mouse skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:225-1:900

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

82061-1-RR targets GSK3B in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag17320

  Product name: Recombinant human GSK3B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 355-433 aa of BC000251

  Sequence: ELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST

• Full Name: glycogen synthase kinase 3 beta
• Calculated Molecular Weight: 433 aa, 48 kDa
• Observed Molecular Weight: ~45 kDa
• GenBank Accession Number: BC000251
• Gene Symbol: GSK3B
• Gene ID (NCBI): 2932
• RRID: AB_3086460
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P49841
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glycogen synthase kinase-3 (GSK3) is a proline-directed serine-threonine kinase that was initially identified as a phosphorylating and inactivating glycogen synthase.GSK3B is involved in energy metabolism, neuronal cell development, and body pattern formation. In skeletal muscle, it contributes to INS regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis.

Publications

What published studies show

The GSK3B Recombinant monoclonal antibody (catalog number 82061-1-RR) has 37 citations. These appear in journals including ACS Nano, Journal of Advanced Research, Redox Biology, Genes & Diseases, Cell Reports, Journal of Biological Chemistry, Journal of Virology, Journal of Alzheimer's Disease Reports, and Frontiers in Cell and Developmental Biology. Research fields span oncology (colorectal, lung, gastric, breast, liver, pancreatic cancers), diabetes and metabolic disorders, neurodegeneration (Alzheimer's), inflammation and sepsis, bone and tissue regeneration, ferroptosis, and Wnt/β-catenin and PI3K-AKT signaling pathways.

Automatically generated from the 37 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	ACS Nano; Flowerbed-Inspired Mg-Loaded Scaffold Accelerates Critical-Sized Bone-Defect Repair by Reprogramming the Microenvironment.; Authors - Xinyue Yang
	WB	J Adv Res; Orthosteric-allosteric dual inhibitors of PI5P4Kγ with potent antitumor activity in non-small cell lung cancer; Authors - Liang Xiong
human	WB	Redox Biol; A viral-host redox axis: EBNA1-FOSL2-ALDH3A1 defines a targetable vulnerability in EBV-positive carcinomas.; Authors - Qian Liu
human	WB	Genes Dis; UBR5 regulates the progression of colorectal cancer cells through Snail-induced epithelial-mesenchymal transition.; Authors - Xinyue Zhao
		Phytomedicine; Eupatilin inhibits non-small cell lung cancer metastasis by suppressing Netrin-1-mediated epithelial-mesenchymal transition.; Authors - Bo Xu
rat	WB	Adv Healthc Mater; Biomimetic Multilayered Gas-Foaming Scaffold with Sustained bFGF Delivery for Annulus Fibrosus Regeneration.; Authors - Yujie Chen