Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells, A549 cells, Jurkat cells, PC-12 cells, NIH/3T3 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:225-1:900 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 23 publications below |
| IHC | See 1 publications below |
| IF | See 2 publications below |
Product Information
82061-1-RR targets GSK3B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag17320 Product name: Recombinant human GSK3B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 355-433 aa of BC000251 Sequence: ELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST Predict reactive species |
| Full Name | glycogen synthase kinase 3 beta |
| Calculated Molecular Weight | 433 aa, 48 kDa |
| Observed Molecular Weight | ~45 kDa |
| GenBank Accession Number | BC000251 |
| Gene Symbol | GSK3B |
| Gene ID (NCBI) | 2932 |
| RRID | AB_3086460 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P49841 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Glycogen synthase kinase-3 (GSK3) is a proline-directed serine-threonine kinase that was initially identified as a phosphorylating and inactivating glycogen synthase.GSK3B is involved in energy metabolism, neuronal cell development, and body pattern formation. In skeletal muscle, it contributes to INS regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GSK3B antibody 82061-1-RR | Download protocol |
| IP protocol for GSK3B antibody 82061-1-RR | Download protocol |
| WB protocol for GSK3B antibody 82061-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Virol Metformin hydrochloride regulates glycolysis and inhibits PEDV replication by inhibition of PI3K-AKT signaling pathway. | ||
Chin Med Emodin promotes GSK-3β-mediated PD-L1 proteasomal degradation and enhances anti-tumor immunity in hepatocellular carcinoma. | ||
Fitoterapia Impatiens shenglanii exerts antithrombotic effects by inhibiting the PI3K/Akt/GSK3B signaling pathway and reprogramming arachidonic acid metabolism. | ||
Int Immunopharmacol Kaempferide alleviates glucocorticoid-induced osteoporosis by targeting ferroptosis through the GSK3β/Nrf-2/GPX4 pathway. | ||
J Diabetes Res Shengdihuang Xiyangshen Zhimu Cangzhu Formula Improves Hepatic Glycogen Synthesis via the JNK/c-Jun/IRS1/GSK3β Signaling Pathway. | ||
Redox Biol A viral-host redox axis: EBNA1-FOSL2-ALDH3A1 defines a targetable vulnerability in EBV-positive carcinomas. |
