Tested Applications
Positive WB detected in | human placenta tissue |
Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunohistochemistry (IHC) | IHC : 1:10000-1:40000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
85182-1-RR targets Glycophorin A/CD235a in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Eg2336 Product name: Recombinant Human Glycophorin A protein (rFc Tag)(HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 20-91 aa of BC005319 Sequence: SSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE Predict reactive species |
Full Name | glycophorin A (MNS blood group) |
Calculated Molecular Weight | 150 aa, 16 kDa |
Observed Molecular Weight | 35-38 kDa |
GenBank Accession Number | BC005319 |
Gene Symbol | Glycophorin A |
Gene ID (NCBI) | 2993 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P02724 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Glycophorin A (GYPA), also known as CD235a, is the major transmembrane sialoglycoprotein in erythrocytes. It is a dimeric type I transmembrane protein carrying 15 closely clustered O-linked tetrasaccharides capped with sialic acid/N-acetylneuraminic acid (Neu5Ac). Glycophorin A represents the major sialoglycoprotein of the red blood cell membrane displaying about one million copies per cell. (PMID: 9490702)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Glycophorin A/CD235a antibody 85182-1-RR | Download protocol |
IHC protocol for Glycophorin A/CD235a antibody 85182-1-RR | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |