Glycophorin A/CD235a Recombinant monoclonal antibody

• 

  WB analysis of human placenta using 85182-1-RR

  Human placenta tissue was subjected to SDS PAGE, followed by western blot with 85182-1-RR (GYPA antibody) at a dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human placenta using 85182-1-RR

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 85182-1-RR (Glycophorin A/CD235a antibody) at dilution of 1:20000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 85182-1-RR

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 85182-1-RR (Glycophorin A/CD235a antibody) at dilution of 1:20000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Glycophorin A/CD235a Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 85182-1-RR

Clone No.242822C9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Glycophorin A, 242822C9, CD235a, Glycophorin-A, GPA

---

Tested Applications

• Positive WB detected in: human placenta tissue
• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:10000-1:40000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85182-1-RR targets Glycophorin A/CD235a in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2336

  Product name: Recombinant Human Glycophorin A protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 20-91 aa of BC005319

  Sequence: SSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

• Full Name: glycophorin A (MNS blood group)
• Calculated Molecular Weight: 150 aa, 16 kDa
• Observed Molecular Weight: 35-38 kDa
• GenBank Accession Number: BC005319
• Gene Symbol: Glycophorin A
• Gene ID (NCBI): 2993
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P02724
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glycophorin A (GYPA), also known as CD235a, is the major transmembrane sialoglycoprotein in erythrocytes. It is a dimeric type I transmembrane protein carrying 15 closely clustered O-linked tetrasaccharides capped with sialic acid/N-acetylneuraminic acid (Neu5Ac). Glycophorin A represents the major sialoglycoprotein of the red blood cell membrane displaying about one million copies per cell. (PMID: 9490702)