• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Galectin-3 Polyclonal antibody

Galectin-3 Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-14979

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

35 kDa lectin, Carbohydrate-binding protein 35, CBP 35, CBP35, Gal 3

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-14979 targets Galectin-3 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6891

Product name: Recombinant human Galectin 3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-250 aa of BC001120

Sequence: MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

Predict reactive species
Full Name lectin, galactoside-binding, soluble, 3
Calculated Molecular Weight 26 kDa
Observed Molecular Weight 31 kDa
GenBank Accession NumberBC001120
Gene Symbol Galectin-3
Gene ID (NCBI) 3958
RRIDAB_2919106
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP17931
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Galectins are a family of animal lectins defined by shared characteristic amino-acid sequences and affinity for β-galactose-containing oligosac-charides (PMID: 8063692). Galectin-3, a member of the β-galactoside-binding proteins, contains one carbohydrate recognition domain (CRD) and a proline- and glycine-rich N-terminal domain through which is able to form oligomers (PMID: 14758078). Galectin-3 is widely expressed in many normal tissues and a variety of tumors. It is found intracellularly in nucleus and cytoplasm or secreted outside of cell, being present on the cell surface or in the extracellular space (PMID: 16478649). Galectin-3 is involved in various biological processes including cell growth, adhesion, differentiation, apoptosis, angiogenesis, immune response, neoplastic transformation and metastasis (PMID: 16478649; 14758078).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 Galectin-3 antibody CL488-14979Download protocol
IF protocol for CL Plus 488 Galectin-3 antibody CL488-14979Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse

J Cell Biol

Proteolytic regulation of a galectin-3/Lrp1 axis controls osteoclast-mediated bone resorption

Authors - Lingxin Zhu
Loading...
||
New chat

Able

正在加载,请稍候...