CoraLite® Plus 647 Anti-Human Glycophorin A/CD235a Rabbit Recombinant Antibody

Glycophorin A/CD235a Uni-rAb® Recombinant Antibody for FC
Cat No. CL647-98370-2
Clone No.242822E1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Glycophorin A, CD235a, Glycophorin-A, GPA, GPErik

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inHuman peripheral blood erythrocytes

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in a 100 µl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-98370-2 targets Glycophorin A/CD235a in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2336

Product name: Recombinant Human Glycophorin A protein (rFc Tag)(HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 20-91 aa of BC005319

Sequence: SSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Predict reactive species
Full Name glycophorin A (MNS blood group)
Calculated Molecular Weight 150 aa, 16 kDa
GenBank Accession NumberBC005319
Gene Symbol Glycophorin A
Gene ID (NCBI) 2993
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP02724
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Glycophorin A (GYPA) is the major transmembrane sialoglycoprotein in erythrocytes. It is a dimeric type I transmembrane protein carrying 15 closely clustered O-linked tetrasaccharides capped with sialic acid/N-acetylneuraminic acid (Neu5Ac). This 36 kDa protein represents the major sialoglycoprotein of the red blood cell membrane displaying about one million copies per cell. (PMID: 9490702)

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 Glycophorin A/CD235a antibody CL647-98370-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...