Tested Applications
| Positive FC detected in | Human peripheral blood erythrocytes |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) | FC : 5 ul per 10^6 cells in a 100 µl suspension |
| This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL647-98370-2 targets Glycophorin A/CD235a in FC applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg2336 Product name: Recombinant Human Glycophorin A protein (rFc Tag)(HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 20-91 aa of BC005319 Sequence: SSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE Predict reactive species |
| Full Name | glycophorin A (MNS blood group) |
| Calculated Molecular Weight | 150 aa, 16 kDa |
| GenBank Accession Number | BC005319 |
| Gene Symbol | Glycophorin A |
| Gene ID (NCBI) | 2993 |
| Conjugate | CoraLite® Plus 647 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 654 nm / 674 nm |
| Excitation Laser | Red Laser (633 nm) |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P02724 |
| Storage Buffer | PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
Background Information
Glycophorin A (GYPA) is the major transmembrane sialoglycoprotein in erythrocytes. It is a dimeric type I transmembrane protein carrying 15 closely clustered O-linked tetrasaccharides capped with sialic acid/N-acetylneuraminic acid (Neu5Ac). This 36 kDa protein represents the major sialoglycoprotein of the red blood cell membrane displaying about one million copies per cell. (PMID: 9490702)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 647 Glycophorin A/CD235a antibody CL647-98370-2 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

