Biotin Anti-Human Glycophorin A/CD235a Rabbit Recombinant Antibody

• 

  FC experiment of Human peripheral blood erythrocytes using Biotin-98370-2

  1x10^6 Human peripheral blood erythrocytes were surface stained with 5 ul Biotin Anti-Human Glycophorin A/CD235a Rabbit RecAb (Biotin-98370-2, Clone: 242822E1) and CoraLite®488-conjugated streptavidin (red), or unstained (blue). Cells were not fixed.

Glycophorin A/CD235a Uni-rAb^® Recombinant Antibody for FC, ELISA

Cat No. Biotin-98370-2

Clone No.242822E1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC, ELISA

Synonyms

Glycophorin A, CD235a, Glycophorin-A, GPA, GPErik

---

Tested Applications

• Positive FC detected in: Human peripheral blood erythrocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-98370-2 targets Glycophorin A/CD235a in FC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2336

  Product name: Recombinant Human Glycophorin A protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 20-91 aa of BC005319

  Sequence: SSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

• Full Name: glycophorin A (MNS blood group)
• Calculated Molecular Weight: 150 aa, 16 kDa
• GenBank Accession Number: BC005319
• Gene Symbol: Glycophorin A
• Gene ID (NCBI): 2993
• Conjugate: Biotin
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P02724
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Glycophorin A (GYPA) is the major transmembrane sialoglycoprotein in erythrocytes. It is a dimeric type I transmembrane protein carrying 15 closely clustered O-linked tetrasaccharides capped with sialic acid/N-acetylneuraminic acid (Neu5Ac). This 36 kDa protein represents the major sialoglycoprotein of the red blood cell membrane displaying about one million copies per cell. (PMID: 9490702)