Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

HADHB Monoclonal antibody

HADHB Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67967-1-Ig
Clone No.1D12F4

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, ELISA

1D12F4, 3-ketoacyl-CoA thiolase, Acetyl CoA acyltransferase, Acetyl-CoA acyltransferase, Beta ketothiolase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, HepG2 cells, pig heart tissue, Hela cells, HEK-293 cells, Jurkat cells, Rabbit heart tissues, Rat heart tissues, Mouse heart tissues
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

67967-1-Ig targets HADHB in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivitymouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30315

Product name: Recombinant human HADHB protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 34-262 aa of BC017564

Sequence: RAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLL

Predict reactive species
Full Name hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit
Calculated Molecular Weight 51 kDa
Observed Molecular Weight47 kDa
GenBank Accession NumberBC017564
Gene Symbol HADHB
Gene ID (NCBI) 3032
RRIDAB_2918718
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP55084
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HADHB, also named as TP- beta, Acetyl-CoA acyltransferase and Beta-ketothiolase, is a mitochondrial trifunctional enzyme subunit beta. Mitochondrial trifunctional enzyme catalyzes the last three of the four reactions of the mitochondrial beta-oxidation pathway. The mitochondrial beta-oxidation pathway is the major energy-producing process in tissues and is performed through four consecutive reactions breaking down fatty acids into acetyl-CoA. Among the enzymes involved in this pathway, the trifunctional enzyme exhibits specificity for long-chain fatty acids. Mitochondrial trifunctional enzyme is a heterotetrameric complex composed of two proteins, the trifunctional enzyme subunit alpha/HADHA carries the 2,3-enoyl-CoA hydratase and the 3-hydroxyacyl-CoA dehydrogenase activities, while the trifunctional enzyme subunit beta/HADHB described here bears the 3-ketoacyl-CoA thiolase activity. HADHB has 2 isoforms produced by alternative splicing with the MW of 49 kDa and 51 kDa.

Protocols

Product Specific Protocols
IF protocol for HADHB antibody 67967-1-IgDownload protocol
IHC protocol for HADHB antibody 67967-1-IgDownload protocol
WB protocol for HADHB antibody 67967-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

bioRxiv

Mitochondrial ATP production promotes T cell differentiation and function by regulating chromatin accessibility.

Authors - Charles Ng
Loading...
||
New chat

Able

正在加载,请稍候...