HADHB Monoclonal antibody

• 

  WB analysis using 67967-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67967-1-Ig (HADHB antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  WB analysis using 67967-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67967-1-Ig (HADHB antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 67967-1-Ig

  WB result of HADHB antibody (67967-1-Ig; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-HADHB transfected HepG2 cells.

• 

  IHC staining of human colon cancer using 67967-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67967-1-Ig (HADHB antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 67967-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67967-1-Ig (HADHB antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 67967-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67967-1-Ig (HADHB antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 67967-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using HADHB antibody (67967-1-Ig, Clone: 1D12F4 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of HeLa using 67967-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using HADHB antibody (67967-1-Ig, Clone: 1D12F4 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

HADHB Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67967-1-Ig

Clone No.1D12F4

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

1D12F4, 3-ketoacyl-CoA thiolase, Acetyl CoA acyltransferase, Acetyl-CoA acyltransferase, Beta ketothiolase

---

Tested Applications

• Positive WB detected in: LNCaP cells, HepG2 cells, pig heart tissue, Hela cells, HEK-293 cells, Jurkat cells, Rabbit heart tissues, Rat heart tissues, Mouse heart tissues
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67967-1-Ig targets HADHB in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30315

  Product name: Recombinant human HADHB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 34-262 aa of BC017564

  Sequence: RAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLL

• Full Name: hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit
• Calculated Molecular Weight: 51 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC017564
• Gene Symbol: HADHB
• Gene ID (NCBI): 3032
• RRID: AB_2918718
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P55084
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HADHB, also named as TP- beta, Acetyl-CoA acyltransferase and Beta-ketothiolase, is a mitochondrial trifunctional enzyme subunit beta. Mitochondrial trifunctional enzyme catalyzes the last three of the four reactions of the mitochondrial beta-oxidation pathway. The mitochondrial beta-oxidation pathway is the major energy-producing process in tissues and is performed through four consecutive reactions breaking down fatty acids into acetyl-CoA. Among the enzymes involved in this pathway, the trifunctional enzyme exhibits specificity for long-chain fatty acids. Mitochondrial trifunctional enzyme is a heterotetrameric complex composed of two proteins, the trifunctional enzyme subunit alpha/HADHA carries the 2,3-enoyl-CoA hydratase and the 3-hydroxyacyl-CoA dehydrogenase activities, while the trifunctional enzyme subunit beta/HADHB described here bears the 3-ketoacyl-CoA thiolase activity. HADHB has 2 isoforms produced by alternative splicing with the MW of 49 kDa and 51 kDa.