CoraLite®594-conjugated HADHB Monoclonal antibody

• 

  IF Staining of HeLa using CL594-67967

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite®594 HADHB antibody (CL594-67967, Clone: 1D12F4 ) at dilution of 1:200.

• 

  FC experiment of HeLa using CL594-67967

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite®594 Anti-Human HADHB (CL594-67967, Clone:1D12F4) (red), or 0.4 ug Mouse IgG2b Isotype Control (CL594-66360-3, Clone: K11B8C4B5) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

HADHB Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL594-67967

Clone No.1D12F4

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig

Applications

IF/ICC, FC (Intra)

Synonyms

1D12F4, 3-ketoacyl-CoA thiolase, Acetyl CoA acyltransferase, Acetyl-CoA acyltransferase, Beta ketothiolase

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67967 targets HADHB in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30315

  Product name: Recombinant human HADHB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 34-262 aa of BC017564

  Sequence: RAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLL

• Full Name: hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit
• Calculated Molecular Weight: 51 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC017564
• Gene Symbol: HADHB
• Gene ID (NCBI): 3032
• RRID: AB_2923936
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P55084
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

HADHB, also named as TP- beta, Acetyl-CoA acyltransferase and Beta-ketothiolase, is a mitochondrial trifunctional enzyme subunit beta. Mitochondrial trifunctional enzyme catalyzes the last three of the four reactions of the mitochondrial beta-oxidation pathway. The mitochondrial beta-oxidation pathway is the major energy-producing process in tissues and is performed through four consecutive reactions breaking down fatty acids into acetyl-CoA. Among the enzymes involved in this pathway, the trifunctional enzyme exhibits specificity for long-chain fatty acids. Mitochondrial trifunctional enzyme is a heterotetrameric complex composed of two proteins, the trifunctional enzyme subunit alpha/HADHA carries the 2,3-enoyl-CoA hydratase and the 3-hydroxyacyl-CoA dehydrogenase activities, while the trifunctional enzyme subunit beta/HADHB described here bears the 3-ketoacyl-CoA thiolase activity. HADHB has 2 isoforms produced by alternative splicing with the MW of 49 kDa and 51 kDa.