• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated HADHB Monoclonal antibody

HADHB Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-67967
Clone No.1D12F4

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig

Applications

IF/ICC, FC (Intra)

1D12F4, 3-ketoacyl-CoA thiolase, Acetyl CoA acyltransferase, Acetyl-CoA acyltransferase, Beta ketothiolase

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67967 targets HADHB in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30315

Product name: Recombinant human HADHB protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 34-262 aa of BC017564

Sequence: RAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLL

Predict reactive species
Full Name hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit
Calculated Molecular Weight 51 kDa
Observed Molecular Weight47 kDa
GenBank Accession NumberBC017564
Gene Symbol HADHB
Gene ID (NCBI) 3032
RRIDAB_2923841
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP55084
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

HADHB, also named as TP- beta, Acetyl-CoA acyltransferase and Beta-ketothiolase, is a mitochondrial trifunctional enzyme subunit beta. Mitochondrial trifunctional enzyme catalyzes the last three of the four reactions of the mitochondrial beta-oxidation pathway. The mitochondrial beta-oxidation pathway is the major energy-producing process in tissues and is performed through four consecutive reactions breaking down fatty acids into acetyl-CoA. Among the enzymes involved in this pathway, the trifunctional enzyme exhibits specificity for long-chain fatty acids. Mitochondrial trifunctional enzyme is a heterotetrameric complex composed of two proteins, the trifunctional enzyme subunit alpha/HADHA carries the 2,3-enoyl-CoA hydratase and the 3-hydroxyacyl-CoA dehydrogenase activities, while the trifunctional enzyme subunit beta/HADHB described here bears the 3-ketoacyl-CoA thiolase activity. HADHB has 2 isoforms produced by alternative splicing with the MW of 49 kDa and 51 kDa.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 HADHB antibody CL488-67967Download protocol
IF protocol for CL Plus 488 HADHB antibody CL488-67967Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...