HCLS1 Recombinant monoclonal antibody, PBS Only (Capture)

HCLS1 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 85114-1-PBS
Clone No.242825E4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

242825E4, CTTNL, Hematopoietic cell-specific LYN substrate 1, Hematopoietic lineage cell-specific protein, HS1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85114-1-PBS targets HCLS1 as part of a matched antibody pair:

MP01860-1: 85114-1-PBS capture and 85114-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag8645

Product name: Recombinant human HCLS1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 142-486 aa of BC016758

Sequence: GEVEKHTSQKDYSRGFGGRYGVEKDKWDKAALGYDYKGETEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGARGLKAKFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVEEEPVYEAEPEPEPEPEPEPENDYEDVEEMDRHEQEDEPEGDYEEVLEPEDSSFSSALAGSSGCPAGAGAGAVALGISAVALYDYQGEGSDELSFDPDDVITDIEMVDEGWWRGRCHGHFGLFPANYVKLLE

Predict reactive species
Full Name hematopoietic cell-specific Lyn substrate 1
Calculated Molecular Weight 486 aa, 54 kDa
Observed Molecular Weight 75 kDa
GenBank Accession NumberBC016758
Gene Symbol HCLS1
Gene ID (NCBI) 3059
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP14317
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Hematopoietic cell-specific Lyn substrate 1 (HS1, HCLS1, LckBP1 and p75) is a 75-kDa intracellular protein expressed in cells of lymphohemopoietic origin. It was originally identified in B-lymphocytes as a major substrate of B-cell receptor (BCR)-induced phosphorylation after antigen (Ag) stimulation. It's a substrate of the antigen receptor-coupled tyrosine kinase. HCLS1 plays a role in antigen receptor signaling for both clonal expansion and deletion in lymphoid cells.

Loading...