HCLS1 Recombinant monoclonal antibody

• 

  WB analysis using 85114-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85114-1-RR (HCLS1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat thymus using 85114-1-RR

  rat thymus tissue were subjected to SDS PAGE followed by western blot with 85114-1-RR (HCLS1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 85114-1-RR

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 85114-1-RR (HCLS1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse thymus using 85114-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse thymus tissue slide using 85114-1-RR (HCLS1 antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse thymus using 85114-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse thymus tissue slide using 85114-1-RR (HCLS1 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HEL using 85114-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HEL cells using HCLS1 antibody (85114-1-RR, Clone: 242825E4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  IF Staining of Jurkat using 85114-1-RR

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using HCLS1 antibody (85114-1-RR, Clone: 242825E4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity and Kinetic Characterization of 85114-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85114-1-RR against Human HCLS1 were performed. The affinity constant is 4.71 nM.

HCLS1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 85114-1-RR

Clone No.242825E4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

242825E4, CTTNL, Hematopoietic cell-specific LYN substrate 1, Hematopoietic lineage cell-specific protein, HS1

---

Tested Applications

• Positive WB detected in: Jurkat cells, mouse thymus tissue, rat thymus tissue, Ramos cells, Daudi cells, Raji cells
• Positive IHC detected in: mouse thymus tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEL cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:400-1:1600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85114-1-RR targets HCLS1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8645

  Product name: Recombinant human HCLS1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 142-486 aa of BC016758

  Sequence: GEVEKHTSQKDYSRGFGGRYGVEKDKWDKAALGYDYKGETEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGARGLKAKFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVEEEPVYEAEPEPEPEPEPEPENDYEDVEEMDRHEQEDEPEGDYEEVLEPEDSSFSSALAGSSGCPAGAGAGAVALGISAVALYDYQGEGSDELSFDPDDVITDIEMVDEGWWRGRCHGHFGLFPANYVKLLE

• Full Name: hematopoietic cell-specific Lyn substrate 1
• Calculated Molecular Weight: 486 aa, 54 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC016758
• Gene Symbol: HCLS1
• Gene ID (NCBI): 3059
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P14317
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Hematopoietic cell-specific Lyn substrate 1 (HS1, HCLS1, LckBP1 and p75) is a 75-kDa intracellular protein expressed in cells of lymphohemopoietic origin. It was originally identified in B-lymphocytes as a major substrate of B-cell receptor (BCR)-induced phosphorylation after antigen (Ag) stimulation. It's a substrate of the antigen receptor-coupled tyrosine kinase. HCLS1 plays a role in antigen receptor signaling for both clonal expansion and deletion in lymphoid cells.