HDDC2 Monoclonal antibody, PBS Only

• 

  WB analysis using 68391-1-Ig (same clone as 68391-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68391-1-Ig (HDDC2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68391-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 68391-1-Ig (same clone as 68391-1-PBS)

  WB result of HDDC2 antibody (68391-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-HDDC2 transfected HeLa cells. This data was developed using the same antibody clone with 68391-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 68391-1-Ig (same clone as 68391-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 68391-1-Ig (HDDC2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68391-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 68391-1-Ig (same clone as 68391-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 68391-1-Ig (HDDC2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68391-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Saos-2 using 68391-1-Ig (same clone as 68391-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed Saos-2 cells using HDDC2 antibody (68391-1-Ig, Clone: 2E1B2 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68391-1-PBS in a different storage buffer formulation.

• 

  FC experiment of U2OS using 68391-1-Ig (same clone as 68391-1-PBS)

  1x10^6 U2OS cells were intracellularly stained with 0.4 ug HDDC2 Monoclonal antibody (68391-1-Ig, Clone:2E1B2) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.4 ug Mouse IgG2a isotype control Mouse McAb (66360-2-Ig, Clone: 11A1B2) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 68391-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

HDDC2 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 68391-1-PBS

Clone No.2E1B2

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

2E1B2, 5'-deoxynucleotidase HDDC2, C6orf74, CGI 130, CGI-130

---

Product Information

68391-1-PBS targets HDDC2 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33258

  Product name: Recombinant human HDDC2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 15-218 aa of BC003357

  Sequence: MASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRCVRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLPEDLRKELYELWEEYETQSSAEAKFVKQLDQCEMILQASEYEDLEHKPGRLQDFYDSTAGKFNHPEIVQLVSELEAERSTNIAAAASEPHS

• Full Name: HD domain containing 2
• Calculated Molecular Weight: 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC003357
• Gene Symbol: HDDC2
• Gene ID (NCBI): 51020
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q7Z4H3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HDDC2, also named as C6orf74, plays a role in the maintenance of pluripotency in human ES and iPS cells. HDDC2 is a nuclear‐encoded but mitochondrially localized protein. It has been reported as associated with oxidative metabolism.