Tested Applications
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-11695 targets HMGN1 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2315 Product name: Recombinant human HMGN1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC023984 Sequence: MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSD Predict reactive species |
| Full Name | high-mobility group nucleosome binding domain 1 |
| Calculated Molecular Weight | 100 aa, 11 kDa |
| Observed Molecular Weight | 17 kDa |
| GenBank Accession Number | BC023984 |
| Gene Symbol | HMGN1 |
| Gene ID (NCBI) | 3150 |
| RRID | AB_3672507 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P05114 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
HMGN1 (high-mobility group nucleosome-binding protein 1) is a member of the HMG superfamily of nonhistone chromatin-binding proteins, which which regulate chromatin structure and gene transcription. It binds to the inner side of the nucleosomal DNA thus altering the interaction between the DNA and the histone octamer. It may participate in the process which maintains transcribable genes in an unique chromatin conformation, and inhibit the phosphorylation of nucleosomal histones H3 and H2A by RPS6KA5/MSK1 and RPS6KA3/RSK2 expressed abundantly
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 488 HMGN1 antibody CL488-11695 | Download protocol |
| IF protocol for CL Plus 488 HMGN1 antibody CL488-11695 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



