HNRNPD Monoclonal antibody

HNRNPD Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 68236-1-Ig
Clone No.2G9E6

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat, pig, rabbit and More (1)

Applications

WB, IHC, IF/ICC, ELISA

AUF1, AUF1A, hnRNP D0, HNRNPD, hnRNPD0, HNRPD, P37

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, LNCaP cells, HeLa cells, HEK-293 cells, Jurkat cells, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue
Positive IHC detected inhuman cervical cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

68236-1-Ig targets HNRNPD in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat, pig, rabbit samples.

Tested Reactivity Human, mouse, rat, pig, rabbit
Cited Reactivityhuman
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag3458

Product name: Recombinant human HNRNPD protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-355 aa of BC026015

Sequence: MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY

Predict reactive species
Full Name heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa)
Calculated Molecular Weight 355 aa, 38 kDa
Observed Molecular Weight38 kDa
GenBank Accession NumberBC026015
Gene Symbol HNRNPD
Gene ID (NCBI) 3184
RRIDAB_2935323
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14103
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. HNRNPD, also known as AUF1, belongs to the family of AU-binding proteins (AU-BPs) that regulate the cellular half-lives of many mRNAs by directly interacting with an AU-rich element (ARE) located in their 3′ untranslated region (PMID:8578590,12704645). AUF1 has four isoforms produced by alternative splicing of a single transcript: p37, p40, p42, and p45 (PMID:9521873).

Protocols

Product Specific Protocols
IF protocol for HNRNPD antibody 68236-1-IgDownload protocol
IHC protocol for HNRNPD antibody 68236-1-IgDownload protocol
WB protocol for HNRNPD antibody 68236-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Tissue Cell

Activation of the SIRT1/PGC-1α pathway by HNRNPD promotes vasculogenic mimicry in NSCLC

Authors - Xuefeng Zhang
Loading...
||
New chat Able
正在加载,请稍候...