HNRNPD Monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HNRNPD Monoclonal antibody, PBS Only (68236-1-PBS)

• 

  WB analysis using 68236-1-Ig (same clone as 68236-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68236-1-Ig (HNRNPD antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 68236-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 68236-1-Ig (same clone as 68236-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 68236-1-Ig (HNRNPD antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68236-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 68236-1-Ig (same clone as 68236-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 68236-1-Ig (HNRNPD antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68236-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 68236-1-Ig (same clone as 68236-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using HNRNPD antibody (68236-1-Ig, Clone: 2G9E6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 68236-1-PBS in a different storage buffer formulation.

HNRNPD Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 68236-1-PBS

Clone No.2G9E6

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

AUF1, AUF1A, hnRNP D0, HNRNPD, hnRNPD0, HNRPD, P37

---

Product Information

68236-1-PBS targets HNRNPD in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: Human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3458

  Product name: Recombinant human HNRNPD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-355 aa of BC026015

  Sequence: MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY

• Full Name: heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa)
• Calculated Molecular Weight: 355 aa, 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC026015
• Gene Symbol: HNRNPD
• Gene ID (NCBI): 3184
• RRID: AB_2935323
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14103
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. HNRNPD, also known as AUF1, belongs to the family of AU-binding proteins (AU-BPs) that regulate the cellular half-lives of many mRNAs by directly interacting with an AU-rich element (ARE) located in their 3′ untranslated region (PMID:8578590,12704645). AUF1 has four isoforms produced by alternative splicing of a single transcript: p37, p40, p42, and p45 (PMID:9521873).