CoraLite® Plus 488-conjugated HNRNPD Monoclonal antibody

HNRNPD Monoclonal Antibody for IF/ICC
Cat No. CL488-68236
Clone No.2G9E6

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat, pig, rabbit

Applications

IF/ICC

AUF1, AUF1A, hnRNP D0, HNRNPD, hnRNPD0, HNRPD, P37

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68236 targets HNRNPD in IF/ICC applications and shows reactivity with Human, mouse, rat, pig, rabbit samples.

Tested Reactivity Human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag3458

Product name: Recombinant human HNRNPD protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-355 aa of BC026015

Sequence: MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY

Predict reactive species
Full Name heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa)
Calculated Molecular Weight 355 aa, 38 kDa
Observed Molecular Weight38 kDa
GenBank Accession NumberBC026015
Gene Symbol HNRNPD
Gene ID (NCBI) 3184
RRIDAB_3084452
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14103
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. HNRNPD, also known as AUF1, belongs to the family of AU-binding proteins (AU-BPs) that regulate the cellular half-lives of many mRNAs by directly interacting with an AU-rich element (ARE) located in their 3′ untranslated region (PMID:8578590,12704645). AUF1 has four isoforms produced by alternative splicing of a single transcript: p37, p40, p42, and p45 (PMID:9521873).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 HNRNPD antibody CL488-68236Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...