Filter:
  • Western Blot (WB) analysis of various lysates using Histone H3 Polyclonal antibody (17168-1-AP)

    WB analysis using 17168-1-AP

    Various lysates were subjected to SDS PAGE followed by western blot with 17168-1-AP (Histone H3 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of mouse skeletal muscle tissue using Histone H3 Polyclonal antibody (17168-1-AP)

    WB analysis of mouse skeletal muscle using 17168-1-AP

    mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 17168-1-AP (Histone-H3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of mouse liver tissue using Histone-H3 Polyclonal antibody (17168-1-AP)

    WB analysis of mouse liver using 17168-1-AP

    mouse liver tissue were subjected to SDS PAGE followed by western blot with 17168-1-AP (Histone-H3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of mouse brain tissue using Histone-H3 Polyclonal antibody (17168-1-AP)

    WB analysis of mouse brain using 17168-1-AP

    mouse brain tissue were subjected to SDS PAGE followed by western blot with 17168-1-AP (Histone-H3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of various lysates using Histone-H3 Polyclonal antibody (17168-1-AP)

    WB analysis using 17168-1-AP

    Various lysates were subjected to SDS PAGE followed by western blot with 17168-1-AP (Histone-H3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  • Immunoprecipitation (IP) experiment of MCF-7 cells using Histone H3 Polyclonal antibody (17168-1-AP)

    IP experiment of MCF-7 using 17168-1-AP

    IP result of anti-Histone-H3 (IP:17168-1-AP, 4ug; Detection:17168-1-AP 1:8000) with MCF-7 cells lysate 2120 ug.

  • Immunohistochemistry (IHC) staining of human oesophagus cancer tissue using Histone H3 Polyclonal antibody (17168-1-AP)

    IHC staining of human oesophagus cancer using 17168-1-AP

    Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 17168-1-AP (Histone H3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human oesophagus cancer tissue using Histone H3 Polyclonal antibody (17168-1-AP)

    IHC staining of human oesophagus cancer using 17168-1-AP

    Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 17168-1-AP (Histone H3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human skin cancer tissue using Histone H3 Polyclonal antibody (17168-1-AP)

    IHC staining of human skin cancer using 17168-1-AP

    Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 17168-1-AP (Histone-H3 antibody) at dilution of 1:200 (under 40x lens).

  • Immunohistochemistry (IHC) staining of human skin cancer tissue using Histone H3 Polyclonal antibody (17168-1-AP)

    IHC staining of human skin cancer using 17168-1-AP

    Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 17168-1-AP (Histone-H3 antibody) at dilution of 1:200 (under 10x lens).

  • Immunohistochemistry (IHC) staining of human breast cancer tissue using Histone H3 Polyclonal antibody (17168-1-AP)

    IHC staining of human breast cancer using 17168-1-AP

    Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17168-1-AP (Histone-H3 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human breast cancer tissue using Histone H3 Polyclonal antibody (17168-1-AP)

    IHC staining of human breast cancer using 17168-1-AP

    Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17168-1-AP (Histone-H3 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunofluorescence (IF) / fluorescent staining of HeLa cells using Histone H3 Polyclonal antibody (17168-1-AP)

    IF Staining of HeLa using 17168-1-AP

    Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using Histone-H3 antibody (17168-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  • Immunofluorescence (IF) / fluorescent staining of HeLa cells using Histone H3 Polyclonal antibody (17168-1-AP)

    IF Staining of HeLa using 17168-1-AP

    Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using Histone-H3 antibody (17168-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  • Immunofluorescence (IF) / fluorescent staining of HeLa cells using Histone H3 Polyclonal antibody (17168-1-AP)

    IF Staining of HeLa using 17168-1-AP

    Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using Histone H3 antibody (17168-1-AP) at dilution of 1:1200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), Beta Actin antibody (66009-1-Ig, Clone: 2D4H5, red).

  • Immunofluorescence (IF) / fluorescent staining of HeLa cells using Histone H3 Polyclonal antibody (17168-1-AP)

    IF Staining of HeLa using 17168-1-AP

    Immunofluorescent analysis of HeLa cells using 17168-1-AP (Histone-H3 antibody) at dilution of 1:50 and Rhodamine-Goat anti-Rabbit IgG.

  • Flow cytometry (FC) experiment of HeLa cells using Histone H3 Polyclonal antibody (17168-1-AP)

    FC experiment of HeLa using 17168-1-AP

    1x10^6 HeLa cells were intracellularly stained with 0.25 ug Histone H3 Polyclonal antibody (17168-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

"Histone H3 Antibodies" Comparison

View side-by-side comparison of Histone H3 antibodies from other vendors to find the one that best suits your research needs.
  • Featured Product
  • KD/KO Validated

Histone H3 Polyclonal antibody

Histone H3 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 17168-1-AP
Publications(1191)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (7)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA

H3, HIST2H3A, H3C13, H3C14, H3C15

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, A549 cells, mouse skeletal muscle tissue, mouse liver tissue, mouse brain tissue, Hela cells, HepG cells, MCF-7 cells, NIH/3T3 cells, mouse kidney tissue, rat kidney tissue
Positive IP detected inMCF-7 cells
Positive IHC detected inhuman oesophagus cancer tissue, human skin cancer tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:600-1:2400
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17168-1-AP targets Histone H3 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, monkey, chicken, zebrafish, goat, fish, arabidopsis, yellow catfish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10644

Product name: Recombinant human Histone-H3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-136 aa of BC015544

Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Predict reactive species
Full Name histone cluster 2, H3a
Calculated Molecular Weight 136 aa, 15 kDa
Observed Molecular Weight 15-17 kDa
GenBank Accession NumberBC015544
Gene Symbol Histone H3
Gene ID (NCBI) 333932
RRIDAB_2716755
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ71DI3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Histone-H3, histone cluster 2, H3a is the core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machinery which requires DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Histone-H3 is expressed during S phase; then expression strongly decreases as cell division slows down during the process of differentiation.

Protocols

Product Specific Protocols
FC protocol for Histone H3 antibody 17168-1-APDownload protocol
IF protocol for Histone H3 antibody 17168-1-APDownload protocol
IHC protocol for Histone H3 antibody 17168-1-APDownload protocol
IP protocol for Histone H3 antibody 17168-1-APDownload protocol
WB protocol for Histone H3 antibody 17168-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell

The WDR11 complex is a receptor for acidic-cluster-containing cargo proteins

Authors - Huaqing Deng
humanWB

Nature

The molecular basis of tight nuclear tethering and inactivation of cGAS.

Authors - Baoyu Zhao
WB

Nature

A phase-separated nuclear GBPL circuit controls immunity in plants.

Authors - Shuai Huang
humanWB

Signal Transduct Target Ther

TRAF3 activates STING-mediated suppression of EV-A71 and target of viral evasion

Authors - Wenwen Zheng
humanWB

Mol Cancer

Cell surface CD55 traffics to the nucleus leading to cisplatin resistance and stemness by inducing PRC2 and H3K27 trimethylation on chromatin in ovarian cancer

Authors - Rashmi Bharti
humanWB

Cell

Targeting Epigenetic Crosstalk as a Therapeutic Strategy for EZH2-Aberrant Solid Tumors.

Authors - Xun Huang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Charlotte (Verified Customer) (02-19-2026)

We have one single clear band at the expected size (10 kDa).

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/3000
  • Cell Tissue Type: mesenchymal stem cells
Histone H3 Antibody Western Blot validation (1/3000 dilution) in mesenchymal stem cells (Cat no:17168-1-AP)
FH

Nishita (Verified Customer) (01-19-2026)

A fair bit of off-target binding, but still shows clear histone signals at lower MW. There are usually 2-3 bands for the histones, and a strong nonspecific band at around 30kDa.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000 for WB
  • Cell Tissue Type: Saccharomyces cerevisiae
FH

Felipe (Verified Customer) (07-24-2025)

Histone H3 antibody is a reliable marker for detecting proliferating cells. After optimizing the dilution, I achieved good results in identifying proliferative cells in bovine ovarian tissue using an immunofluorescence assay.

  • Applications: Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:600
  • Cell Tissue Type: Bovine ovarian tissue
Histone H3 Antibody Immunohistochemistry,Immunofluorescence validation (1:600 dilution) in Bovine ovarian tissue (Cat no:17168-1-AP)
FH

Christin (Verified Customer) (06-14-2025)

Antibody worked very vell for western blot using iPSC-derived macrophages and microglia

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: iPSC-derived immune cells
FH

kis (Verified Customer) (02-21-2025)

This antibody gave u satisfactory results in our cell line for Western blot (WB) analysis.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1.1500
FH

Parijat (Verified Customer) (08-19-2024)

Worked on blot.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: IMCD3
FH

Wissem (Verified Customer) (06-27-2024)

Antibody works very well at detecting Histone H3 in extracts from U2OS, HCT116, HeLa, RPE1 and HEK293 cells - used at 1:10,000 to 1:15,000 incubated overnight at 4C

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:10,000
FH

Roy (Verified Customer) (06-12-2024)

This antibody is great at detecting Histone H3 by WB (1/1000- 1h incubation at RT) with beautiful enrichment at the purified chromatin fraction.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: HeLa cells
FH

Mi (Verified Customer) (06-25-2023)

It works very well in nuclear extracts from human brown adipocyte cells.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: human brown adipocytes
FH

Veda (Verified Customer) (04-29-2022)

IF staining test in cryo sections of skin. It does not seem to work. Maybe it only stains the nuclear membrane.

  • Applications: Immunofluorescence
FH

Pradeep (Verified Customer) (09-19-2020)

Good antibody for Western blot. Selvaraju, V., Thirunavukkarasu, M., Joshi, M. et al. Deletion of newly described pro-survival molecule Pellino-1 increases oxidative stress, downregulates cIAP2/NF-κB cell survival pathway, reduces angiogenic response, and thereby aggravates tissue function in mouse ischemic models. Basic Res Cardiol 115, 45 (2020). https://doi.org/10.1007/s00395-020-0804-4

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse Heart Tissue
FH

Tanusree (Verified Customer) (12-03-2019)

The antibody works great in Western blotting analysis.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Mouse brain
FH

Ruiting (Verified Customer) (11-11-2019)

I use the Proteintech antibodies almost every week, the antibodies never failed to me. Very gald to use their products with a great price.Ruiting

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence,
  • Primary Antibody Dilution: 1:1,000
  • Cell Tissue Type: Mouse testis and brains
FH

Robert (Verified Customer) (07-18-2019)

The Histon H3 antibody gives a signal in the three nuclear samples, but not in the cytoplasmic samples.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: ST cells (porcine)
Histone H3 Antibody Western Blot, validation (1/1000 dilution) in ST cells (porcine) (Cat no:17168-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...